GBREL.TXT Genetic Sequence Data Bank April 15 2012 NCBI-GenBank Flat File Release 189.0 Distribution Release Notes 151824421 loci, 139266481398 bases, from 151824421 reported sequences This document describes the format and content of the flat files that comprise releases of the GenBank nucleotide sequence database. If you have any questions or comments about GenBank or this document, please contact NCBI via email at info@ncbi.nlm.nih.gov or: GenBank National Center for Biotechnology Information National Library of Medicine, 38A, 8N805 8600 Rockville Pike Bethesda, MD 20894 USA Phone: (301) 496-2475 Fax: (301) 480-9241 GenBank releases do not include sequence records that originate from third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project. Rather, GenBank is the archival/primary resource which those other efforts draw upon. For information about TPA and RefSeq, please visit: http://www.ncbi.nih.gov/Genbank/TPA.html http://www.ncbi.nlm.nih.gov/RefSeq ========================================================================== TABLE OF CONTENTS ========================================================================== 1. INTRODUCTION 1.1 Release 189.0 1.2 Cutoff Date 1.3 Important Changes in Release 189.0 1.4 Upcoming Changes 1.5 Request for Direct Submission of Sequence Data 1.6 Organization of This Document 2. ORGANIZATION OF DATA FILES 2.1 Overview 2.2 Files 2.2.1 File Descriptions 2.2.5 File Sizes 2.2.6 Per-Division Statistics 2.2.7 Selected Per-Organism Statistics 2.2.8 Growth of GenBank 3. FILE FORMATS 3.1 File Header Information 3.2 Directory Files 3.2.1 Short Directory File 3.3 Index Files 3.3.1 Accession Number Index File 3.3.2 Keyword Phrase Index File 3.3.3 Author Name Index File 3.3.4 Journal Citation Index File 3.3.5 Gene Name Index 3.4 Sequence Entry Files 3.4.1 File Organization 3.4.2 Entry Organization 3.4.3 Sample Sequence Data File 3.4.4 LOCUS Format 3.4.5 DEFINITION Format 3.4.5.1 DEFINITION Format for NLM Entries 3.4.6 ACCESSION Format 3.4.7 VERSION Format 3.4.8 KEYWORDS Format 3.4.9 SEGMENT Format 3.4.10 SOURCE Format 3.4.11 REFERENCE Format 3.4.12 FEATURES Format 3.4.12.1 Feature Key Names 3.4.12.2 Feature Location 3.4.12.3 Feature Qualifiers 3.4.12.4 Cross-Reference Information 3.4.12.5 Feature Table Examples 3.4.13 ORIGIN Format 3.4.14 SEQUENCE Format 3.4.15 CONTIG Format 4. ALTERNATE RELEASES 5. KNOWN PROBLEMS OF THE GENBANK DATABASE 5.1 Incorrect Gene Symbols in Entries and Index 6. GENBANK ADMINISTRATION 6.1 Registered Trademark Notice 6.2 Citing GenBank 6.3 GenBank Distribution Formats and Media 6.4 Other Methods of Accessing GenBank Data 6.5 Request for Corrections and Comments 6.6 Credits and Acknowledgments 6.7 Disclaimer ========================================================================== 1. INTRODUCTION 1.1 Release 189.0 The National Center for Biotechnology Information (NCBI) at the National Library of Medicine (NLM), National Institutes of Health (NIH) is responsible for producing and distributing the GenBank Sequence Database. NCBI handles all GenBank direct submissions and authors are advised to use the address below. Submitters are encouraged to use the free Sequin software package for sending sequence data, or the newly developed World Wide Web submission form. See Section 1.5 below for details. ***************************************************************************** The address for direct submissions to GenBank is: GenBank Submissions National Center for Biotechnology Information Bldg 38A, Rm. 8N-803 8600 Rockville Pike Bethesda, MD 20894 E-MAIL: gb-sub@ncbi.nlm.nih.gov Updates and changes to existing GenBank records: E-MAIL: update@ncbi.nlm.nih.gov URL for GenBank's web-based submission tool (BankIt) : http://www.ncbi.nlm.nih.gov/BankIt (see Section 1.5 for additional details about submitting data to GenBank.) ***************************************************************************** GenBank Release 189.0 is a release of sequence data by NCBI in the GenBank Flatfile format. GenBank is a component of a tri-partite collaboration of sequence databases in the U.S., Europe, and Japan, known as the International Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases are the European Molecular Biology Laboratory (EMBL) at Hinxton Hall, UK, and the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are incorporated through arrangements with the U.S. Patent and Trademark Office, and via the collaborating international databases from other international patent offices. The database is converted to various output formats, including the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1 and Flatfile forms of the data are available at NCBI's anonymous FTP server : ftp://ftp.ncbi.nih.gov/ncbi-asn1 ftp://ftp.ncbi.nih.gov/genbank A mirror of NCBI's GenBank FTP site is available at Indiana University, courtesy of the Bio-Mirror project: ftp://bio-mirror.net/biomirror/genbank/ Some users who experience slow FTP transfers of large files might realize an improvement in transfer rates from this alternate site when the volume of traffic at the NCBI is high. For a list of other Bio-Mirror nodes, visit: http://www.bio-mirror.net/ 1.2 Cutoff Date This full release, 189.0, incorporates data available to the collaborating databases as of April 15, 2012 at approximately 1:30am EDT. For more recent data, users are advised to: o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI: ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format) ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format) o Use the interactive Network-Entrez or Web-Entrez applications to query the 'Entrez: Nucleotides' database (see Section 6.4 of this document). 1.3 Important Changes in Release 189.0 1.3.1 Extension of position syntax for /anticodon qualifiers Starting with the April 2012 GenBank Release 189.0, the format of the /anticodon qualifier has been extended to allow the use of join() and complement() for the location of a tRNA's anticodon. Currently, the qualifier supports only a simple continuous basepair range. For example: /anticodon=(pos:34..36,aa:Phe) But there are rare cases of intron-containing tRNAs, for which a simple X..Y location will not suffice: tRNA join(<1..5,495..544) /gene="trnL" /product="tRNA-Leu" /note="codon recognized: UUA" /anticodon=(pos:join(5,495..496),aa:Leu) To support cases like these, the "pos" field is now allowed to make use of the join() and complement() location operators. Anticodons are usually three (sometimes four) bases in length, and this *remains* true even though the join() operator could theoretically be (mis)used to assert a much more complex/larger location than that. 1.3.2 New representation for Transcriptome Shotgun Assembly (TSA) records. The TSA division of GenBank (see http://www.ncbi.nlm.nih.gov/genbank/tsa for details) has grown much more quickly than expected. To accommodate the increasing TSA submission volume, GenBank plans to use a WGS-like approach for TSA sequencing projects. It is likely that we will start to provide TSA project data in the new format *prior* to Release 190.0 in June 2012. TSA projects will be assigned a four-letter project code, starting with the letter "G" (for example, GAAA). Individual mRNA sequences within a project will make use of the 4+2+6 accession number convention, familiar to users of WGS data (for example, GAAA01000001). Unlike WGS, re-assembly of the mRNAs for a TSA sequencing project is expected to be a very rare occurrence, and we expect that the 2-digit assembly-version number will almost always be "01" for TSA mRNAs. Similar to WGS, a TSA master record will provide a convenient overview of a TSA project, with an 'all-zeroes' accession number (eg: GAAA00000000) . TSA projects that make use of this new representation will be provided in a separate FTP directory at the NCBI FTP site: genbank/tsa . And like WGS, the various data files for a TSA project will be grouped by the 4-letter project code, and they will be updated independently of the GenBank release cycle. Plans aren't yet finalized for the 5.2 million TSA records currently provided in the divisional gbtsa* files of a GenBank release. Ideally, all would be converted to the new WGS-like representation, so that all TSA records in GenBank utilize a common approach. However, the resources for such a conversion might not be readily available, in which case older/legacy TSA records might remain as they are now. Further details about this new approach for handling TSA data will be made available via these release notes and the GenBank newsgroup, as we get closer to implementation. 1.3.3 Organizational changes The total number of sequence data files increased by 28 with this release: - the BCT division is now composed of 85 files (+3) - the CON division is now composed of 167 files (+1) - the ENV division is now composed of 53 files (+3) - the EST division is now composed of 461 files (+6) - the INV division is now composed of 30 files (-2) - the MAM division is now composed of 8 files (+1) - the PAT division is now composed of 178 files (+2) - the PLN division is now composed of 55 files (+2) - the PRI division is now composed of 45 files (+1) - the TSA division is now composed of 70 files (+10) - the VRT division is now composed of 26 files (+1) The decrease in the number of INV-division files was a consequence of the removal of approximately 340,000 BarCode sequence records that lacked tentative taxonomic identification, and hence did not satisfy the terms of the iBOL/GenBank early-release agreement. The total number of 'index' files increased by 1 with this release: - the AUT (author name) index is now composed of 97 files (+1) 1.3.4 Project DBLINKs transitioning to BioProject The Genome Project Database resource at the NCBI was redesigned in recent months, culminating in the implementation of a new BioProject resource: http://www.ncbi.nlm.nih.gov/bioproject An article that describes the goals of BioProject is available: http://www.ncbi.nlm.nih.gov/books/NBK54015/ BioProject is a collaborative effort of the International Nucleotide Sequence Database Collaboration (INSDC), and project data are exchanged with NCBI's partner INSDC institutions, EBI and DDBJ. A BioProject website is also available at DDBJ: http://trace.ddbj.nig.ac.jp/bioproject/index_e.shtml BioProjects are uniquely identified by BioProject Accession Numbers, which utilize this format: "PRJ" "E" or "N" or "D" one letter one or more digits Examples of valid BioProject accessions are PRJNA12521 and PRJEB1 . With BioProject now in operation, we are preparing to implement links from sequence records to the new resource. Previously, links to the Genome Project Database were provided by numeric 'Project' DBLINKs . Here's an example for a bacterial complete-genome record: LOCUS CP002497 1110245 bp DNA linear PLN 14-NOV-2011 DEFINITION Eremothecium cymbalariae DBVPG#7215 chromosome 1, complete sequence. ACCESSION CP002497 VERSION CP002497.1 GI:356887709 DBLINK Project: 60715 When this link is switched to a BioProject accession, the DBLINK line will change slightly: LOCUS CP002497 1110245 bp DNA linear PLN 14-NOV-2011 DEFINITION Eremothecium cymbalariae DBVPG#7215 chromosome 1, complete sequence. ACCESSION CP002497 VERSION CP002497.1 GI:356887709 DBLINK BioProject: PRJNA60715 In the coming months, many millions of sequence records will gradually be modified, to make use of the new BioProject DBLINK. These modifications will not be distributed via daily GenBank and RefSeq incremental-update products. However, the new BioProject links are gradually appearing on newly submitted sequence records, and were present in GenBank and RefSeq release and incremental-update products starting in December 2011. In addition, the new BioProject links are visible via NCBI's Entrez:Nucleotide resource. 1.3.5 Changes in the content of index files As described in the GB 153 release notes, the 'index' files which accompany GenBank releases (see Section 3.3) are considered to be a legacy data product by NCBI, generated mostly for historical reasons. FTP statistics from January 2005 seemed to support this: the index files were transferred only half as frequently as the files of sequence records. The inherent inefficiencies of the index file format also lead us to suspect that they have little serious use by the user community, particularly for EST and GSS records. The software that generated the index file products received little attention over the years, and finally reached its limitations in February 2006 (Release 152.0). The required multi-server queries which obtained and sorted many millions of rows of terms from several different databases simply outgrew the capacity of the hardware used for GenBank Release generation. Our short-term solution is to cease generating some index-file content for all EST sequence records, and for GSS sequence records that originate via direct submission to NCBI. The three gbacc*.idx index files continue to reflect the entirety of the release, including all EST and GSS records, however the file contents are unsorted. These 'solutions' are really just stop-gaps, and we will likely pursue one of two options: a) Cease support of the 'index' file products altogether. b) Provide new products that present some of the most useful data from the legacy 'index' files, and cease support for other types of index data. If you are a user of the 'index' files associated with GenBank releases, we encourage you to make your wishes known, either via the GenBank newsgroup, or via email to NCBI's Service Desk: info@ncbi.nlm.nih.gov Our apologies for any inconvenience that these changes may cause. 1.3.6 GSS File Header Problem GSS sequences at GenBank are maintained in two different systems, depending on their origin, and the dumps from those systems occur in parallel. Because the second dump (for example) has no prior knowledge of exactly how many GSS files will be dumped by the first, it does not know how to number its own output files. There is thus a discrepancy between the filenames and file headers for 103 of the GSS flatfiles in Release 189.0. Consider gbgss153.seq : GBGSS1.SEQ Genetic Sequence Data Bank April 15 2012 NCBI-GenBank Flat File Release 189.0 GSS Sequences (Part 1) 87113 loci, 63992234 bases, from 87113 reported sequences Here, the filename and part number in the header is "1", though the file has been renamed as "153" based on the number of files dumped from the other system. We hope to resolve this discrepancy at some point, but the priority is certainly much lower than many other tasks. 1.4 Upcoming Changes 1.4.2 New /pseudogene qualifier; /pseudo will be deprecated A new controlled-vocabulary /pseudogene qualifier has been under discussion within the INSDC since the last collaborative INSD meeting in May 2011. The goal of the new qualifier is to use it for the annotation of certain well-defined classes of pseudogenes. And at the same time, to cease using the poorly-defined /pseudo qualifier, which has been used for a variety of different situations by each INSDC member. Although a formal definition of /pseudogene is not yet available, we do have a tentative list of the values for the new qualifier: "processed" - the pseudogene has arisen by reverse transcription of a mRNA into cDNA, followed by reintegration into the genome. Therefore, it has lost any intron/exon structure, and it will have a pseudo-polyA-tail (if a young pseudogene). "unprocessed" - the pseudogene has arisen from a copy of the parent gene by means other than reverse transcription. This covers usually duplication (transposition [not retrotransposition] and perhaps recombination) followed by accumulation of random mutation. The changes, compared to their functional homolog, include insertion, deletions, premature stop codons, frameshifts and a higher proportion of non-synonymous versus synonymous substitutions. "unitary" - the pseudogene has no parent. It is the original gene, which is functional is some species but disrupted in some way (indels, mutation, recombination) in another species or strain. In a lot of cases, such changes would kill the organism, particularly with house-keeping genes. "allelic" - a (unitary) pseudogene that is stable in the population but importantly it has a functional alternative allele also in the population. i.e., one strain may have the gene, another strain may have the pseudogene. MHC haplotypes have allelic pseudogenes. "unknown" - would imply that the submitter does not know the method of pseudogenisation If a final definition of /pseudogene can be arrived at within the next few weeks, then the new qualifier would be legal as of GenBank Release 190.0 in June of 2012. We will keep users posted about this new qualifier via the GenBank newsgroup and these release notes. 1.5 Request for Direct Submission of Sequence Data A successful GenBank requires that sequence data enter the database as soon as possible after publication, that the annotations be as complete as possible, and that the sequence and annotation data be accurate. All three of these requirements are best met if authors of sequence data submit their data directly to GenBank in a usable form. It is especially important that these submissions be in computer-readable form. GenBank must rely on direct author submission of data to ensure that it achieves its goals of completeness, accuracy, and timeliness. To assist researchers in entering their own sequence data, GenBank provides a WWW submission tool called BankIt, as well as a stand-alone software package called Sequin. BankIt and Sequin are both easy-to-use programs that enable authors to enter a sequence, annotate it, and submit it to GenBank. Through the international collaboration of DNA sequence databases, GenBank submissions are forwarded daily for inclusion in the EMBL and DDBJ databases. SEQUIN. Sequin is an interactive, graphically-oriented program based on screen forms and controlled vocabularies that guides you through the process of entering your sequence and providing biological and bibliographic annotation. Sequin is designed to simplify the sequence submission process, and to provide increased data handling capabilities to accomodate very long sequences, complex annotations, and robust error checking. E-mail the completed submission file to : gb-sub@ncbi.nlm.nih.gov Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers. It is available by annonymous ftp from ftp.ncbi.nih.gov; login as anonymous and use your e-mail address as the password. It is located in the sequin directory. Or direct your web browser to this URL: ftp://ftp.ncbi.nih.gov/sequin BANKIT. BankIt provides a simple forms-based approach for submitting your sequence and descriptive information to GenBank. Your submission will be submitted directly to GenBank via the World Wide Web, and immediately forwarded for inclusion in the EMBL and DDBJ databases. BankIt may be used with Netscape, Internet Explorer, and other common WWW clients. You can access BankIt from GenBank's home page: http://www.ncbi.nlm.nih.gov/ AUTHORIN. Authorin sequence submissions are no longer accepted by GenBank, and the Authorin application is no longer distributed by NCBI. If you have questions about GenBank submissions or any of the data submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475. 1.6 Organization of This Document The second section describes the contents of GenBank releases. The third section illustrates the formats of the flat files. The fourth section describes other versions of the data, the fifth section identifies known prob- lems, and the sixth contains administrative details. 2. ORGANIZATION OF DATA FILES 2.1 Overview GenBank releases consist of a set of ASCII text files, most of which contain sequence data. A few supplemental "index" files are also supplied, containing comprehensive lists of author names, journal citations, gene names, and keywords, along with the accession numbers of the records in which they can be found (see Section 3.3). The line-lengths of these files is variable. 2.2 Files This GenBank flat file release consists of 1790 files. The lists that follow describe each of the files included in the distribution. Their sizes and base pair content are also summarized. 2.2.1 File Descriptions Files included in this release are: 1. gbacc1.idx - Index of the entries according to accession number, part 1. 2. gbacc2.idx - Index of the entries according to accession number, part 2. 3. gbacc3.idx - Index of the entries according to accession number, part 3. 4. gbaut1.idx - Index of the entries according to author name, part 1. 5. gbaut10.idx - Index of the entries according to author name, part 10. 6. gbaut11.idx - Index of the entries according to author name, part 11. 7. gbaut12.idx - Index of the entries according to author name, part 12. 8. gbaut13.idx - Index of the entries according to author name, part 13. 9. gbaut14.idx - Index of the entries according to author name, part 14. 10. gbaut15.idx - Index of the entries according to author name, part 15. 11. gbaut16.idx - Index of the entries according to author name, part 16. 12. gbaut17.idx - Index of the entries according to author name, part 17. 13. gbaut18.idx - Index of the entries according to author name, part 18. 14. gbaut19.idx - Index of the entries according to author name, part 19. 15. gbaut2.idx - Index of the entries according to author name, part 2. 16. gbaut20.idx - Index of the entries according to author name, part 20. 17. gbaut21.idx - Index of the entries according to author name, part 21. 18. gbaut22.idx - Index of the entries according to author name, part 22. 19. gbaut23.idx - Index of the entries according to author name, part 23. 20. gbaut24.idx - Index of the entries according to author name, part 24. 21. gbaut25.idx - Index of the entries according to author name, part 25. 22. gbaut26.idx - Index of the entries according to author name, part 26. 23. gbaut27.idx - Index of the entries according to author name, part 27. 24. gbaut28.idx - Index of the entries according to author name, part 28. 25. gbaut29.idx - Index of the entries according to author name, part 29. 26. gbaut3.idx - Index of the entries according to author name, part 3. 27. gbaut30.idx - Index of the entries according to author name, part 30. 28. gbaut31.idx - Index of the entries according to author name, part 31. 29. gbaut32.idx - Index of the entries according to author name, part 32. 30. gbaut33.idx - Index of the entries according to author name, part 33. 31. gbaut34.idx - Index of the entries according to author name, part 34. 32. gbaut35.idx - Index of the entries according to author name, part 35. 33. gbaut36.idx - Index of the entries according to author name, part 36. 34. gbaut37.idx - Index of the entries according to author name, part 37. 35. gbaut38.idx - Index of the entries according to author name, part 38. 36. gbaut39.idx - Index of the entries according to author name, part 39. 37. gbaut4.idx - Index of the entries according to author name, part 4. 38. gbaut40.idx - Index of the entries according to author name, part 40. 39. gbaut41.idx - Index of the entries according to author name, part 41. 40. gbaut42.idx - Index of the entries according to author name, part 42. 41. gbaut43.idx - Index of the entries according to author name, part 43. 42. gbaut44.idx - Index of the entries according to author name, part 44. 43. gbaut45.idx - Index of the entries according to author name, part 45. 44. gbaut46.idx - Index of the entries according to author name, part 46. 45. gbaut47.idx - Index of the entries according to author name, part 47. 46. gbaut48.idx - Index of the entries according to author name, part 48. 47. gbaut49.idx - Index of the entries according to author name, part 49. 48. gbaut5.idx - Index of the entries according to author name, part 5. 49. gbaut50.idx - Index of the entries according to author name, part 50. 50. gbaut51.idx - Index of the entries according to author name, part 51. 51. gbaut52.idx - Index of the entries according to author name, part 52. 52. gbaut53.idx - Index of the entries according to author name, part 53. 53. gbaut54.idx - Index of the entries according to author name, part 54. 54. gbaut55.idx - Index of the entries according to author name, part 55. 55. gbaut56.idx - Index of the entries according to author name, part 56. 56. gbaut57.idx - Index of the entries according to author name, part 57. 57. gbaut58.idx - Index of the entries according to author name, part 58. 58. gbaut59.idx - Index of the entries according to author name, part 59. 59. gbaut6.idx - Index of the entries according to author name, part 6. 60. gbaut60.idx - Index of the entries according to author name, part 60. 61. gbaut61.idx - Index of the entries according to author name, part 61. 62. gbaut62.idx - Index of the entries according to author name, part 62. 63. gbaut63.idx - Index of the entries according to author name, part 63. 64. gbaut64.idx - Index of the entries according to author name, part 64. 65. gbaut65.idx - Index of the entries according to author name, part 65. 66. gbaut66.idx - Index of the entries according to author name, part 66. 67. gbaut67.idx - Index of the entries according to author name, part 67. 68. gbaut68.idx - Index of the entries according to author name, part 68. 69. gbaut69.idx - Index of the entries according to author name, part 69. 70. gbaut7.idx - Index of the entries according to author name, part 7. 71. gbaut70.idx - Index of the entries according to author name, part 70. 72. gbaut71.idx - Index of the entries according to author name, part 71. 73. gbaut72.idx - Index of the entries according to author name, part 72. 74. gbaut73.idx - Index of the entries according to author name, part 73. 75. gbaut74.idx - Index of the entries according to author name, part 74. 76. gbaut75.idx - Index of the entries according to author name, part 75. 77. gbaut76.idx - Index of the entries according to author name, part 76. 78. gbaut77.idx - Index of the entries according to author name, part 77. 79. gbaut78.idx - Index of the entries according to author name, part 78. 80. gbaut79.idx - Index of the entries according to author name, part 79. 81. gbaut8.idx - Index of the entries according to author name, part 8. 82. gbaut80.idx - Index of the entries according to author name, part 80. 83. gbaut81.idx - Index of the entries according to author name, part 81. 84. gbaut82.idx - Index of the entries according to author name, part 82. 85. gbaut83.idx - Index of the entries according to author name, part 83. 86. gbaut84.idx - Index of the entries according to author name, part 84. 87. gbaut85.idx - Index of the entries according to author name, part 85. 88. gbaut86.idx - Index of the entries according to author name, part 86. 89. gbaut87.idx - Index of the entries according to author name, part 87. 90. gbaut88.idx - Index of the entries according to author name, part 88. 91. gbaut89.idx - Index of the entries according to author name, part 89. 92. gbaut9.idx - Index of the entries according to author name, part 9. 93. gbaut90.idx - Index of the entries according to author name, part 90. 94. gbaut91.idx - Index of the entries according to author name, part 91. 95. gbaut92.idx - Index of the entries according to author name, part 92. 96. gbaut93.idx - Index of the entries according to author name, part 93. 97. gbaut94.idx - Index of the entries according to author name, part 94. 98. gbaut95.idx - Index of the entries according to author name, part 95. 99. gbaut96.idx - Index of the entries according to author name, part 96. 100. gbaut97.idx - Index of the entries according to author name, part 97. 101. gbbct1.seq - Bacterial sequence entries, part 1. 102. gbbct10.seq - Bacterial sequence entries, part 10. 103. gbbct11.seq - Bacterial sequence entries, part 11. 104. gbbct12.seq - Bacterial sequence entries, part 12. 105. gbbct13.seq - Bacterial sequence entries, part 13. 106. gbbct14.seq - Bacterial sequence entries, part 14. 107. gbbct15.seq - Bacterial sequence entries, part 15. 108. gbbct16.seq - Bacterial sequence entries, part 16. 109. gbbct17.seq - Bacterial sequence entries, part 17. 110. gbbct18.seq - Bacterial sequence entries, part 18. 111. gbbct19.seq - Bacterial sequence entries, part 19. 112. gbbct2.seq - Bacterial sequence entries, part 2. 113. gbbct20.seq - Bacterial sequence entries, part 20. 114. gbbct21.seq - Bacterial sequence entries, part 21. 115. gbbct22.seq - Bacterial sequence entries, part 22. 116. gbbct23.seq - Bacterial sequence entries, part 23. 117. gbbct24.seq - Bacterial sequence entries, part 24. 118. gbbct25.seq - Bacterial sequence entries, part 25. 119. gbbct26.seq - Bacterial sequence entries, part 26. 120. gbbct27.seq - Bacterial sequence entries, part 27. 121. gbbct28.seq - Bacterial sequence entries, part 28. 122. gbbct29.seq - Bacterial sequence entries, part 29. 123. gbbct3.seq - Bacterial sequence entries, part 3. 124. gbbct30.seq - Bacterial sequence entries, part 30. 125. gbbct31.seq - Bacterial sequence entries, part 31. 126. gbbct32.seq - Bacterial sequence entries, part 32. 127. gbbct33.seq - Bacterial sequence entries, part 33. 128. gbbct34.seq - Bacterial sequence entries, part 34. 129. gbbct35.seq - Bacterial sequence entries, part 35. 130. gbbct36.seq - Bacterial sequence entries, part 36. 131. gbbct37.seq - Bacterial sequence entries, part 37. 132. gbbct38.seq - Bacterial sequence entries, part 38. 133. gbbct39.seq - Bacterial sequence entries, part 39. 134. gbbct4.seq - Bacterial sequence entries, part 4. 135. gbbct40.seq - Bacterial sequence entries, part 40. 136. gbbct41.seq - Bacterial sequence entries, part 41. 137. gbbct42.seq - Bacterial sequence entries, part 42. 138. gbbct43.seq - Bacterial sequence entries, part 43. 139. gbbct44.seq - Bacterial sequence entries, part 44. 140. gbbct45.seq - Bacterial sequence entries, part 45. 141. gbbct46.seq - Bacterial sequence entries, part 46. 142. gbbct47.seq - Bacterial sequence entries, part 47. 143. gbbct48.seq - Bacterial sequence entries, part 48. 144. gbbct49.seq - Bacterial sequence entries, part 49. 145. gbbct5.seq - Bacterial sequence entries, part 5. 146. gbbct50.seq - Bacterial sequence entries, part 50. 147. gbbct51.seq - Bacterial sequence entries, part 51. 148. gbbct52.seq - Bacterial sequence entries, part 52. 149. gbbct53.seq - Bacterial sequence entries, part 53. 150. gbbct54.seq - Bacterial sequence entries, part 54. 151. gbbct55.seq - Bacterial sequence entries, part 55. 152. gbbct56.seq - Bacterial sequence entries, part 56. 153. gbbct57.seq - Bacterial sequence entries, part 57. 154. gbbct58.seq - Bacterial sequence entries, part 58. 155. gbbct59.seq - Bacterial sequence entries, part 59. 156. gbbct6.seq - Bacterial sequence entries, part 6. 157. gbbct60.seq - Bacterial sequence entries, part 60. 158. gbbct61.seq - Bacterial sequence entries, part 61. 159. gbbct62.seq - Bacterial sequence entries, part 62. 160. gbbct63.seq - Bacterial sequence entries, part 63. 161. gbbct64.seq - Bacterial sequence entries, part 64. 162. gbbct65.seq - Bacterial sequence entries, part 65. 163. gbbct66.seq - Bacterial sequence entries, part 66. 164. gbbct67.seq - Bacterial sequence entries, part 67. 165. gbbct68.seq - Bacterial sequence entries, part 68. 166. gbbct69.seq - Bacterial sequence entries, part 69. 167. gbbct7.seq - Bacterial sequence entries, part 7. 168. gbbct70.seq - Bacterial sequence entries, part 70. 169. gbbct71.seq - Bacterial sequence entries, part 71. 170. gbbct72.seq - Bacterial sequence entries, part 72. 171. gbbct73.seq - Bacterial sequence entries, part 73. 172. gbbct74.seq - Bacterial sequence entries, part 74. 173. gbbct75.seq - Bacterial sequence entries, part 75. 174. gbbct76.seq - Bacterial sequence entries, part 76. 175. gbbct77.seq - Bacterial sequence entries, part 77. 176. gbbct78.seq - Bacterial sequence entries, part 78. 177. gbbct79.seq - Bacterial sequence entries, part 79. 178. gbbct8.seq - Bacterial sequence entries, part 8. 179. gbbct80.seq - Bacterial sequence entries, part 80. 180. gbbct81.seq - Bacterial sequence entries, part 81. 181. gbbct82.seq - Bacterial sequence entries, part 82. 182. gbbct83.seq - Bacterial sequence entries, part 83. 183. gbbct84.seq - Bacterial sequence entries, part 84. 184. gbbct85.seq - Bacterial sequence entries, part 85. 185. gbbct9.seq - Bacterial sequence entries, part 9. 186. gbchg.txt - Accession numbers of entries updated since the previous release. 187. gbcon1.seq - Constructed sequence entries, part 1. 188. gbcon10.seq - Constructed sequence entries, part 10. 189. gbcon100.seq - Constructed sequence entries, part 100. 190. gbcon101.seq - Constructed sequence entries, part 101. 191. gbcon102.seq - Constructed sequence entries, part 102. 192. gbcon103.seq - Constructed sequence entries, part 103. 193. gbcon104.seq - Constructed sequence entries, part 104. 194. gbcon105.seq - Constructed sequence entries, part 105. 195. gbcon106.seq - Constructed sequence entries, part 106. 196. gbcon107.seq - Constructed sequence entries, part 107. 197. gbcon108.seq - Constructed sequence entries, part 108. 198. gbcon109.seq - Constructed sequence entries, part 109. 199. gbcon11.seq - Constructed sequence entries, part 11. 200. gbcon110.seq - Constructed sequence entries, part 110. 201. gbcon111.seq - Constructed sequence entries, part 111. 202. gbcon112.seq - Constructed sequence entries, part 112. 203. gbcon113.seq - Constructed sequence entries, part 113. 204. gbcon114.seq - Constructed sequence entries, part 114. 205. gbcon115.seq - Constructed sequence entries, part 115. 206. gbcon116.seq - Constructed sequence entries, part 116. 207. gbcon117.seq - Constructed sequence entries, part 117. 208. gbcon118.seq - Constructed sequence entries, part 118. 209. gbcon119.seq - Constructed sequence entries, part 119. 210. gbcon12.seq - Constructed sequence entries, part 12. 211. gbcon120.seq - Constructed sequence entries, part 120. 212. gbcon121.seq - Constructed sequence entries, part 121. 213. gbcon122.seq - Constructed sequence entries, part 122. 214. gbcon123.seq - Constructed sequence entries, part 123. 215. gbcon124.seq - Constructed sequence entries, part 124. 216. gbcon125.seq - Constructed sequence entries, part 125. 217. gbcon126.seq - Constructed sequence entries, part 126. 218. gbcon127.seq - Constructed sequence entries, part 127. 219. gbcon128.seq - Constructed sequence entries, part 128. 220. gbcon129.seq - Constructed sequence entries, part 129. 221. gbcon13.seq - Constructed sequence entries, part 13. 222. gbcon130.seq - Constructed sequence entries, part 130. 223. gbcon131.seq - Constructed sequence entries, part 131. 224. gbcon132.seq - Constructed sequence entries, part 132. 225. gbcon133.seq - Constructed sequence entries, part 133. 226. gbcon134.seq - Constructed sequence entries, part 134. 227. gbcon135.seq - Constructed sequence entries, part 135. 228. gbcon136.seq - Constructed sequence entries, part 136. 229. gbcon137.seq - Constructed sequence entries, part 137. 230. gbcon138.seq - Constructed sequence entries, part 138. 231. gbcon139.seq - Constructed sequence entries, part 139. 232. gbcon14.seq - Constructed sequence entries, part 14. 233. gbcon140.seq - Constructed sequence entries, part 140. 234. gbcon141.seq - Constructed sequence entries, part 141. 235. gbcon142.seq - Constructed sequence entries, part 142. 236. gbcon143.seq - Constructed sequence entries, part 143. 237. gbcon144.seq - Constructed sequence entries, part 144. 238. gbcon145.seq - Constructed sequence entries, part 145. 239. gbcon146.seq - Constructed sequence entries, part 146. 240. gbcon147.seq - Constructed sequence entries, part 147. 241. gbcon148.seq - Constructed sequence entries, part 148. 242. gbcon149.seq - Constructed sequence entries, part 149. 243. gbcon15.seq - Constructed sequence entries, part 15. 244. gbcon150.seq - Constructed sequence entries, part 150. 245. gbcon151.seq - Constructed sequence entries, part 151. 246. gbcon152.seq - Constructed sequence entries, part 152. 247. gbcon153.seq - Constructed sequence entries, part 153. 248. gbcon154.seq - Constructed sequence entries, part 154. 249. gbcon155.seq - Constructed sequence entries, part 155. 250. gbcon156.seq - Constructed sequence entries, part 156. 251. gbcon157.seq - Constructed sequence entries, part 157. 252. gbcon158.seq - Constructed sequence entries, part 158. 253. gbcon159.seq - Constructed sequence entries, part 159. 254. gbcon16.seq - Constructed sequence entries, part 16. 255. gbcon160.seq - Constructed sequence entries, part 160. 256. gbcon161.seq - Constructed sequence entries, part 161. 257. gbcon162.seq - Constructed sequence entries, part 162. 258. gbcon163.seq - Constructed sequence entries, part 163. 259. gbcon164.seq - Constructed sequence entries, part 164. 260. gbcon165.seq - Constructed sequence entries, part 165. 261. gbcon166.seq - Constructed sequence entries, part 166. 262. gbcon167.seq - Constructed sequence entries, part 167. 263. gbcon17.seq - Constructed sequence entries, part 17. 264. gbcon18.seq - Constructed sequence entries, part 18. 265. gbcon19.seq - Constructed sequence entries, part 19. 266. gbcon2.seq - Constructed sequence entries, part 2. 267. gbcon20.seq - Constructed sequence entries, part 20. 268. gbcon21.seq - Constructed sequence entries, part 21. 269. gbcon22.seq - Constructed sequence entries, part 22. 270. gbcon23.seq - Constructed sequence entries, part 23. 271. gbcon24.seq - Constructed sequence entries, part 24. 272. gbcon25.seq - Constructed sequence entries, part 25. 273. gbcon26.seq - Constructed sequence entries, part 26. 274. gbcon27.seq - Constructed sequence entries, part 27. 275. gbcon28.seq - Constructed sequence entries, part 28. 276. gbcon29.seq - Constructed sequence entries, part 29. 277. gbcon3.seq - Constructed sequence entries, part 3. 278. gbcon30.seq - Constructed sequence entries, part 30. 279. gbcon31.seq - Constructed sequence entries, part 31. 280. gbcon32.seq - Constructed sequence entries, part 32. 281. gbcon33.seq - Constructed sequence entries, part 33. 282. gbcon34.seq - Constructed sequence entries, part 34. 283. gbcon35.seq - Constructed sequence entries, part 35. 284. gbcon36.seq - Constructed sequence entries, part 36. 285. gbcon37.seq - Constructed sequence entries, part 37. 286. gbcon38.seq - Constructed sequence entries, part 38. 287. gbcon39.seq - Constructed sequence entries, part 39. 288. gbcon4.seq - Constructed sequence entries, part 4. 289. gbcon40.seq - Constructed sequence entries, part 40. 290. gbcon41.seq - Constructed sequence entries, part 41. 291. gbcon42.seq - Constructed sequence entries, part 42. 292. gbcon43.seq - Constructed sequence entries, part 43. 293. gbcon44.seq - Constructed sequence entries, part 44. 294. gbcon45.seq - Constructed sequence entries, part 45. 295. gbcon46.seq - Constructed sequence entries, part 46. 296. gbcon47.seq - Constructed sequence entries, part 47. 297. gbcon48.seq - Constructed sequence entries, part 48. 298. gbcon49.seq - Constructed sequence entries, part 49. 299. gbcon5.seq - Constructed sequence entries, part 5. 300. gbcon50.seq - Constructed sequence entries, part 50. 301. gbcon51.seq - Constructed sequence entries, part 51. 302. gbcon52.seq - Constructed sequence entries, part 52. 303. gbcon53.seq - Constructed sequence entries, part 53. 304. gbcon54.seq - Constructed sequence entries, part 54. 305. gbcon55.seq - Constructed sequence entries, part 55. 306. gbcon56.seq - Constructed sequence entries, part 56. 307. gbcon57.seq - Constructed sequence entries, part 57. 308. gbcon58.seq - Constructed sequence entries, part 58. 309. gbcon59.seq - Constructed sequence entries, part 59. 310. gbcon6.seq - Constructed sequence entries, part 6. 311. gbcon60.seq - Constructed sequence entries, part 60. 312. gbcon61.seq - Constructed sequence entries, part 61. 313. gbcon62.seq - Constructed sequence entries, part 62. 314. gbcon63.seq - Constructed sequence entries, part 63. 315. gbcon64.seq - Constructed sequence entries, part 64. 316. gbcon65.seq - Constructed sequence entries, part 65. 317. gbcon66.seq - Constructed sequence entries, part 66. 318. gbcon67.seq - Constructed sequence entries, part 67. 319. gbcon68.seq - Constructed sequence entries, part 68. 320. gbcon69.seq - Constructed sequence entries, part 69. 321. gbcon7.seq - Constructed sequence entries, part 7. 322. gbcon70.seq - Constructed sequence entries, part 70. 323. gbcon71.seq - Constructed sequence entries, part 71. 324. gbcon72.seq - Constructed sequence entries, part 72. 325. gbcon73.seq - Constructed sequence entries, part 73. 326. gbcon74.seq - Constructed sequence entries, part 74. 327. gbcon75.seq - Constructed sequence entries, part 75. 328. gbcon76.seq - Constructed sequence entries, part 76. 329. gbcon77.seq - Constructed sequence entries, part 77. 330. gbcon78.seq - Constructed sequence entries, part 78. 331. gbcon79.seq - Constructed sequence entries, part 79. 332. gbcon8.seq - Constructed sequence entries, part 8. 333. gbcon80.seq - Constructed sequence entries, part 80. 334. gbcon81.seq - Constructed sequence entries, part 81. 335. gbcon82.seq - Constructed sequence entries, part 82. 336. gbcon83.seq - Constructed sequence entries, part 83. 337. gbcon84.seq - Constructed sequence entries, part 84. 338. gbcon85.seq - Constructed sequence entries, part 85. 339. gbcon86.seq - Constructed sequence entries, part 86. 340. gbcon87.seq - Constructed sequence entries, part 87. 341. gbcon88.seq - Constructed sequence entries, part 88. 342. gbcon89.seq - Constructed sequence entries, part 89. 343. gbcon9.seq - Constructed sequence entries, part 9. 344. gbcon90.seq - Constructed sequence entries, part 90. 345. gbcon91.seq - Constructed sequence entries, part 91. 346. gbcon92.seq - Constructed sequence entries, part 92. 347. gbcon93.seq - Constructed sequence entries, part 93. 348. gbcon94.seq - Constructed sequence entries, part 94. 349. gbcon95.seq - Constructed sequence entries, part 95. 350. gbcon96.seq - Constructed sequence entries, part 96. 351. gbcon97.seq - Constructed sequence entries, part 97. 352. gbcon98.seq - Constructed sequence entries, part 98. 353. gbcon99.seq - Constructed sequence entries, part 99. 354. gbdel.txt - Accession numbers of entries deleted since the previous release. 355. gbenv1.seq - Environmental sampling sequence entries, part 1. 356. gbenv10.seq - Environmental sampling sequence entries, part 10. 357. gbenv11.seq - Environmental sampling sequence entries, part 11. 358. gbenv12.seq - Environmental sampling sequence entries, part 12. 359. gbenv13.seq - Environmental sampling sequence entries, part 13. 360. gbenv14.seq - Environmental sampling sequence entries, part 14. 361. gbenv15.seq - Environmental sampling sequence entries, part 15. 362. gbenv16.seq - Environmental sampling sequence entries, part 16. 363. gbenv17.seq - Environmental sampling sequence entries, part 17. 364. gbenv18.seq - Environmental sampling sequence entries, part 18. 365. gbenv19.seq - Environmental sampling sequence entries, part 19. 366. gbenv2.seq - Environmental sampling sequence entries, part 2. 367. gbenv20.seq - Environmental sampling sequence entries, part 20. 368. gbenv21.seq - Environmental sampling sequence entries, part 21. 369. gbenv22.seq - Environmental sampling sequence entries, part 22. 370. gbenv23.seq - Environmental sampling sequence entries, part 23. 371. gbenv24.seq - Environmental sampling sequence entries, part 24. 372. gbenv25.seq - Environmental sampling sequence entries, part 25. 373. gbenv26.seq - Environmental sampling sequence entries, part 26. 374. gbenv27.seq - Environmental sampling sequence entries, part 27. 375. gbenv28.seq - Environmental sampling sequence entries, part 28. 376. gbenv29.seq - Environmental sampling sequence entries, part 29. 377. gbenv3.seq - Environmental sampling sequence entries, part 3. 378. gbenv30.seq - Environmental sampling sequence entries, part 30. 379. gbenv31.seq - Environmental sampling sequence entries, part 31. 380. gbenv32.seq - Environmental sampling sequence entries, part 32. 381. gbenv33.seq - Environmental sampling sequence entries, part 33. 382. gbenv34.seq - Environmental sampling sequence entries, part 34. 383. gbenv35.seq - Environmental sampling sequence entries, part 35. 384. gbenv36.seq - Environmental sampling sequence entries, part 36. 385. gbenv37.seq - Environmental sampling sequence entries, part 37. 386. gbenv38.seq - Environmental sampling sequence entries, part 38. 387. gbenv39.seq - Environmental sampling sequence entries, part 39. 388. gbenv4.seq - Environmental sampling sequence entries, part 4. 389. gbenv40.seq - Environmental sampling sequence entries, part 40. 390. gbenv41.seq - Environmental sampling sequence entries, part 41. 391. gbenv42.seq - Environmental sampling sequence entries, part 42. 392. gbenv43.seq - Environmental sampling sequence entries, part 43. 393. gbenv44.seq - Environmental sampling sequence entries, part 44. 394. gbenv45.seq - Environmental sampling sequence entries, part 45. 395. gbenv46.seq - Environmental sampling sequence entries, part 46. 396. gbenv47.seq - Environmental sampling sequence entries, part 47. 397. gbenv48.seq - Environmental sampling sequence entries, part 48. 398. gbenv49.seq - Environmental sampling sequence entries, part 49. 399. gbenv5.seq - Environmental sampling sequence entries, part 5. 400. gbenv50.seq - Environmental sampling sequence entries, part 50. 401. gbenv51.seq - Environmental sampling sequence entries, part 51. 402. gbenv52.seq - Environmental sampling sequence entries, part 52. 403. gbenv53.seq - Environmental sampling sequence entries, part 53. 404. gbenv6.seq - Environmental sampling sequence entries, part 6. 405. gbenv7.seq - Environmental sampling sequence entries, part 7. 406. gbenv8.seq - Environmental sampling sequence entries, part 8. 407. gbenv9.seq - Environmental sampling sequence entries, part 9. 408. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1. 409. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10. 410. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100. 411. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101. 412. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102. 413. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103. 414. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104. 415. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105. 416. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106. 417. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107. 418. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108. 419. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109. 420. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11. 421. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110. 422. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111. 423. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112. 424. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113. 425. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114. 426. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115. 427. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116. 428. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117. 429. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118. 430. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119. 431. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12. 432. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120. 433. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121. 434. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122. 435. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123. 436. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124. 437. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125. 438. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126. 439. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127. 440. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128. 441. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129. 442. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13. 443. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130. 444. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131. 445. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132. 446. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133. 447. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134. 448. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135. 449. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136. 450. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137. 451. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138. 452. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139. 453. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14. 454. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140. 455. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141. 456. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142. 457. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143. 458. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144. 459. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145. 460. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146. 461. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147. 462. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148. 463. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149. 464. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15. 465. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150. 466. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151. 467. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152. 468. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153. 469. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154. 470. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155. 471. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156. 472. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157. 473. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158. 474. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159. 475. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16. 476. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160. 477. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161. 478. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162. 479. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163. 480. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164. 481. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165. 482. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166. 483. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167. 484. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168. 485. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169. 486. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17. 487. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170. 488. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171. 489. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172. 490. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173. 491. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174. 492. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175. 493. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176. 494. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177. 495. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178. 496. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179. 497. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18. 498. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180. 499. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181. 500. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182. 501. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183. 502. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184. 503. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185. 504. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186. 505. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187. 506. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188. 507. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189. 508. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19. 509. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190. 510. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191. 511. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192. 512. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193. 513. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194. 514. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195. 515. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196. 516. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197. 517. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198. 518. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199. 519. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2. 520. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20. 521. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200. 522. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201. 523. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202. 524. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203. 525. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204. 526. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205. 527. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206. 528. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207. 529. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208. 530. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209. 531. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21. 532. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210. 533. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211. 534. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212. 535. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213. 536. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214. 537. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215. 538. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216. 539. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217. 540. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218. 541. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219. 542. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22. 543. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220. 544. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221. 545. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222. 546. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223. 547. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224. 548. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225. 549. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226. 550. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227. 551. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228. 552. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229. 553. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23. 554. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230. 555. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231. 556. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232. 557. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233. 558. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234. 559. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235. 560. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236. 561. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237. 562. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238. 563. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239. 564. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24. 565. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240. 566. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241. 567. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242. 568. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243. 569. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244. 570. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245. 571. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246. 572. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247. 573. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248. 574. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249. 575. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25. 576. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250. 577. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251. 578. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252. 579. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253. 580. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254. 581. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255. 582. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256. 583. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257. 584. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258. 585. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259. 586. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26. 587. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260. 588. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261. 589. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262. 590. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263. 591. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264. 592. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265. 593. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266. 594. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267. 595. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268. 596. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269. 597. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27. 598. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270. 599. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271. 600. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272. 601. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273. 602. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274. 603. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275. 604. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276. 605. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277. 606. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278. 607. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279. 608. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28. 609. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280. 610. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281. 611. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282. 612. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283. 613. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284. 614. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285. 615. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286. 616. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287. 617. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288. 618. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289. 619. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29. 620. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290. 621. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291. 622. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292. 623. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293. 624. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294. 625. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295. 626. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296. 627. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297. 628. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298. 629. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299. 630. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3. 631. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30. 632. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300. 633. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301. 634. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302. 635. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303. 636. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304. 637. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305. 638. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306. 639. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307. 640. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308. 641. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309. 642. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31. 643. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310. 644. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311. 645. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312. 646. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313. 647. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314. 648. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315. 649. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316. 650. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317. 651. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318. 652. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319. 653. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32. 654. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320. 655. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321. 656. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322. 657. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323. 658. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324. 659. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325. 660. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326. 661. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327. 662. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328. 663. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329. 664. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33. 665. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330. 666. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331. 667. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332. 668. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333. 669. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334. 670. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335. 671. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336. 672. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337. 673. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338. 674. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339. 675. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34. 676. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340. 677. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341. 678. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342. 679. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343. 680. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344. 681. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345. 682. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346. 683. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347. 684. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348. 685. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349. 686. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35. 687. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350. 688. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351. 689. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352. 690. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353. 691. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354. 692. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355. 693. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356. 694. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357. 695. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358. 696. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359. 697. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36. 698. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360. 699. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361. 700. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362. 701. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363. 702. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364. 703. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365. 704. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366. 705. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367. 706. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368. 707. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369. 708. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37. 709. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370. 710. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371. 711. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372. 712. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373. 713. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374. 714. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375. 715. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376. 716. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377. 717. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378. 718. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379. 719. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38. 720. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380. 721. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381. 722. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382. 723. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383. 724. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384. 725. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385. 726. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386. 727. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387. 728. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388. 729. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389. 730. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39. 731. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390. 732. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391. 733. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392. 734. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393. 735. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394. 736. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395. 737. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396. 738. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397. 739. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398. 740. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399. 741. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4. 742. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40. 743. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400. 744. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401. 745. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402. 746. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403. 747. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404. 748. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405. 749. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406. 750. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407. 751. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408. 752. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409. 753. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41. 754. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410. 755. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411. 756. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412. 757. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413. 758. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414. 759. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415. 760. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416. 761. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417. 762. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418. 763. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419. 764. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42. 765. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420. 766. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421. 767. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422. 768. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423. 769. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424. 770. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425. 771. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426. 772. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427. 773. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428. 774. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429. 775. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43. 776. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430. 777. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431. 778. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432. 779. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433. 780. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434. 781. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435. 782. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436. 783. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437. 784. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438. 785. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439. 786. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44. 787. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440. 788. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441. 789. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442. 790. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443. 791. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444. 792. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445. 793. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446. 794. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447. 795. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448. 796. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449. 797. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45. 798. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450. 799. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451. 800. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452. 801. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453. 802. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454. 803. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455. 804. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456. 805. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457. 806. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458. 807. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459. 808. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46. 809. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460. 810. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461. 811. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47. 812. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48. 813. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49. 814. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5. 815. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50. 816. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51. 817. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52. 818. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53. 819. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54. 820. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55. 821. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56. 822. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57. 823. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58. 824. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59. 825. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6. 826. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60. 827. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61. 828. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62. 829. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63. 830. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64. 831. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65. 832. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66. 833. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67. 834. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68. 835. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69. 836. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7. 837. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70. 838. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71. 839. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72. 840. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73. 841. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74. 842. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75. 843. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76. 844. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77. 845. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78. 846. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79. 847. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8. 848. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80. 849. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81. 850. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82. 851. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83. 852. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84. 853. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85. 854. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86. 855. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87. 856. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88. 857. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89. 858. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9. 859. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90. 860. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91. 861. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92. 862. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93. 863. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94. 864. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95. 865. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96. 866. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97. 867. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98. 868. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99. 869. gbgen.idx - Index of the entries according to gene symbols. 870. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1. 871. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10. 872. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100. 873. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101. 874. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102. 875. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103. 876. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104. 877. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105. 878. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106. 879. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107. 880. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108. 881. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109. 882. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11. 883. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110. 884. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111. 885. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112. 886. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113. 887. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114. 888. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115. 889. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116. 890. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117. 891. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118. 892. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119. 893. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12. 894. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120. 895. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121. 896. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122. 897. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123. 898. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124. 899. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125. 900. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126. 901. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127. 902. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128. 903. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129. 904. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13. 905. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130. 906. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131. 907. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132. 908. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133. 909. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134. 910. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135. 911. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136. 912. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137. 913. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138. 914. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139. 915. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14. 916. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140. 917. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141. 918. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142. 919. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143. 920. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144. 921. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145. 922. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146. 923. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147. 924. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148. 925. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149. 926. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15. 927. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150. 928. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151. 929. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152. 930. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153. 931. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154. 932. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155. 933. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156. 934. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157. 935. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158. 936. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159. 937. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16. 938. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160. 939. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161. 940. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162. 941. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163. 942. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164. 943. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165. 944. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166. 945. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167. 946. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168. 947. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169. 948. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17. 949. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170. 950. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171. 951. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172. 952. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173. 953. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174. 954. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175. 955. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176. 956. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177. 957. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178. 958. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179. 959. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18. 960. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180. 961. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181. 962. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182. 963. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183. 964. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184. 965. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185. 966. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186. 967. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187. 968. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188. 969. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189. 970. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19. 971. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190. 972. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191. 973. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192. 974. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193. 975. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194. 976. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195. 977. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196. 978. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197. 979. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198. 980. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199. 981. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2. 982. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20. 983. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200. 984. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201. 985. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202. 986. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203. 987. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204. 988. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205. 989. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206. 990. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207. 991. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208. 992. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209. 993. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21. 994. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210. 995. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211. 996. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212. 997. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213. 998. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214. 999. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215. 1000. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216. 1001. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217. 1002. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218. 1003. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219. 1004. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22. 1005. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220. 1006. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221. 1007. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222. 1008. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223. 1009. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224. 1010. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225. 1011. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226. 1012. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227. 1013. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228. 1014. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229. 1015. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23. 1016. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230. 1017. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231. 1018. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232. 1019. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233. 1020. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234. 1021. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235. 1022. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236. 1023. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237. 1024. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238. 1025. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239. 1026. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24. 1027. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240. 1028. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241. 1029. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242. 1030. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243. 1031. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244. 1032. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245. 1033. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246. 1034. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247. 1035. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248. 1036. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249. 1037. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25. 1038. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250. 1039. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251. 1040. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252. 1041. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253. 1042. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254. 1043. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255. 1044. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26. 1045. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27. 1046. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28. 1047. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29. 1048. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3. 1049. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30. 1050. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31. 1051. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32. 1052. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33. 1053. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34. 1054. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35. 1055. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36. 1056. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37. 1057. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38. 1058. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39. 1059. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4. 1060. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40. 1061. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41. 1062. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42. 1063. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43. 1064. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44. 1065. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45. 1066. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46. 1067. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47. 1068. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48. 1069. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49. 1070. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5. 1071. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50. 1072. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51. 1073. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52. 1074. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53. 1075. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54. 1076. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55. 1077. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56. 1078. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57. 1079. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58. 1080. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59. 1081. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6. 1082. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60. 1083. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61. 1084. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62. 1085. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63. 1086. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64. 1087. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65. 1088. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66. 1089. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67. 1090. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68. 1091. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69. 1092. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7. 1093. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70. 1094. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71. 1095. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72. 1096. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73. 1097. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74. 1098. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75. 1099. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76. 1100. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77. 1101. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78. 1102. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79. 1103. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8. 1104. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80. 1105. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81. 1106. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82. 1107. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83. 1108. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84. 1109. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85. 1110. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86. 1111. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87. 1112. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88. 1113. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89. 1114. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9. 1115. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90. 1116. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91. 1117. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92. 1118. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93. 1119. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94. 1120. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95. 1121. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96. 1122. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97. 1123. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98. 1124. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99. 1125. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1. 1126. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10. 1127. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11. 1128. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12. 1129. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13. 1130. gbhtc14.seq - HTC (high throughput cDNA sequencing) sequence entries, part 14. 1131. gbhtc15.seq - HTC (high throughput cDNA sequencing) sequence entries, part 15. 1132. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2. 1133. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3. 1134. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4. 1135. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5. 1136. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6. 1137. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7. 1138. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8. 1139. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9. 1140. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1. 1141. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10. 1142. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100. 1143. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101. 1144. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102. 1145. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103. 1146. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104. 1147. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105. 1148. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106. 1149. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107. 1150. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108. 1151. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109. 1152. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11. 1153. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110. 1154. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111. 1155. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112. 1156. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113. 1157. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114. 1158. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115. 1159. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116. 1160. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117. 1161. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118. 1162. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119. 1163. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12. 1164. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120. 1165. gbhtg121.seq - HTGS (high throughput genomic sequencing) sequence entries, part 121. 1166. gbhtg122.seq - HTGS (high throughput genomic sequencing) sequence entries, part 122. 1167. gbhtg123.seq - HTGS (high throughput genomic sequencing) sequence entries, part 123. 1168. gbhtg124.seq - HTGS (high throughput genomic sequencing) sequence entries, part 124. 1169. gbhtg125.seq - HTGS (high throughput genomic sequencing) sequence entries, part 125. 1170. gbhtg126.seq - HTGS (high throughput genomic sequencing) sequence entries, part 126. 1171. gbhtg127.seq - HTGS (high throughput genomic sequencing) sequence entries, part 127. 1172. gbhtg128.seq - HTGS (high throughput genomic sequencing) sequence entries, part 128. 1173. gbhtg129.seq - HTGS (high throughput genomic sequencing) sequence entries, part 129. 1174. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13. 1175. gbhtg130.seq - HTGS (high throughput genomic sequencing) sequence entries, part 130. 1176. gbhtg131.seq - HTGS (high throughput genomic sequencing) sequence entries, part 131. 1177. gbhtg132.seq - HTGS (high throughput genomic sequencing) sequence entries, part 132. 1178. gbhtg133.seq - HTGS (high throughput genomic sequencing) sequence entries, part 133. 1179. gbhtg134.seq - HTGS (high throughput genomic sequencing) sequence entries, part 134. 1180. gbhtg135.seq - HTGS (high throughput genomic sequencing) sequence entries, part 135. 1181. gbhtg136.seq - HTGS (high throughput genomic sequencing) sequence entries, part 136. 1182. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14. 1183. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15. 1184. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16. 1185. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17. 1186. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18. 1187. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19. 1188. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2. 1189. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20. 1190. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21. 1191. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22. 1192. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23. 1193. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24. 1194. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25. 1195. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26. 1196. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27. 1197. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28. 1198. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29. 1199. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3. 1200. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30. 1201. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31. 1202. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32. 1203. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33. 1204. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34. 1205. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35. 1206. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36. 1207. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37. 1208. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38. 1209. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39. 1210. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4. 1211. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40. 1212. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41. 1213. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42. 1214. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43. 1215. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44. 1216. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45. 1217. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46. 1218. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47. 1219. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48. 1220. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49. 1221. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5. 1222. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50. 1223. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51. 1224. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52. 1225. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53. 1226. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54. 1227. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55. 1228. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56. 1229. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57. 1230. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58. 1231. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59. 1232. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6. 1233. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60. 1234. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61. 1235. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62. 1236. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63. 1237. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64. 1238. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65. 1239. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66. 1240. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67. 1241. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68. 1242. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69. 1243. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7. 1244. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70. 1245. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71. 1246. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72. 1247. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73. 1248. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74. 1249. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75. 1250. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76. 1251. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77. 1252. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78. 1253. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79. 1254. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8. 1255. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80. 1256. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81. 1257. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82. 1258. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83. 1259. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84. 1260. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85. 1261. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86. 1262. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87. 1263. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88. 1264. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89. 1265. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9. 1266. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90. 1267. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91. 1268. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92. 1269. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93. 1270. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94. 1271. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95. 1272. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96. 1273. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97. 1274. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98. 1275. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99. 1276. gbinv1.seq - Invertebrate sequence entries, part 1. 1277. gbinv10.seq - Invertebrate sequence entries, part 10. 1278. gbinv11.seq - Invertebrate sequence entries, part 11. 1279. gbinv12.seq - Invertebrate sequence entries, part 12. 1280. gbinv13.seq - Invertebrate sequence entries, part 13. 1281. gbinv14.seq - Invertebrate sequence entries, part 14. 1282. gbinv15.seq - Invertebrate sequence entries, part 15. 1283. gbinv16.seq - Invertebrate sequence entries, part 16. 1284. gbinv17.seq - Invertebrate sequence entries, part 17. 1285. gbinv18.seq - Invertebrate sequence entries, part 18. 1286. gbinv19.seq - Invertebrate sequence entries, part 19. 1287. gbinv2.seq - Invertebrate sequence entries, part 2. 1288. gbinv20.seq - Invertebrate sequence entries, part 20. 1289. gbinv21.seq - Invertebrate sequence entries, part 21. 1290. gbinv22.seq - Invertebrate sequence entries, part 22. 1291. gbinv23.seq - Invertebrate sequence entries, part 23. 1292. gbinv24.seq - Invertebrate sequence entries, part 24. 1293. gbinv25.seq - Invertebrate sequence entries, part 25. 1294. gbinv26.seq - Invertebrate sequence entries, part 26. 1295. gbinv27.seq - Invertebrate sequence entries, part 27. 1296. gbinv28.seq - Invertebrate sequence entries, part 28. 1297. gbinv29.seq - Invertebrate sequence entries, part 29. 1298. gbinv3.seq - Invertebrate sequence entries, part 3. 1299. gbinv30.seq - Invertebrate sequence entries, part 30. 1300. gbinv4.seq - Invertebrate sequence entries, part 4. 1301. gbinv5.seq - Invertebrate sequence entries, part 5. 1302. gbinv6.seq - Invertebrate sequence entries, part 6. 1303. gbinv7.seq - Invertebrate sequence entries, part 7. 1304. gbinv8.seq - Invertebrate sequence entries, part 8. 1305. gbinv9.seq - Invertebrate sequence entries, part 9. 1306. gbjou1.idx - Index of the entries according to journal citation, part 1. 1307. gbjou10.idx - Index of the entries according to journal citation, part 10. 1308. gbjou11.idx - Index of the entries according to journal citation, part 11. 1309. gbjou12.idx - Index of the entries according to journal citation, part 12. 1310. gbjou13.idx - Index of the entries according to journal citation, part 13. 1311. gbjou2.idx - Index of the entries according to journal citation, part 2. 1312. gbjou3.idx - Index of the entries according to journal citation, part 3. 1313. gbjou4.idx - Index of the entries according to journal citation, part 4. 1314. gbjou5.idx - Index of the entries according to journal citation, part 5. 1315. gbjou6.idx - Index of the entries according to journal citation, part 6. 1316. gbjou7.idx - Index of the entries according to journal citation, part 7. 1317. gbjou8.idx - Index of the entries according to journal citation, part 8. 1318. gbjou9.idx - Index of the entries according to journal citation, part 9. 1319. gbkey1.idx - Index of the entries according to keyword phrase, part 1. 1320. gbkey2.idx - Index of the entries according to keyword phrase, part 2. 1321. gbkey3.idx - Index of the entries according to keyword phrase, part 3. 1322. gbkey4.idx - Index of the entries according to keyword phrase, part 4. 1323. gbkey5.idx - Index of the entries according to keyword phrase, part 5. 1324. gbkey6.idx - Index of the entries according to keyword phrase, part 6. 1325. gbmam1.seq - Other mammalian sequence entries, part 1. 1326. gbmam2.seq - Other mammalian sequence entries, part 2. 1327. gbmam3.seq - Other mammalian sequence entries, part 3. 1328. gbmam4.seq - Other mammalian sequence entries, part 4. 1329. gbmam5.seq - Other mammalian sequence entries, part 5. 1330. gbmam6.seq - Other mammalian sequence entries, part 6. 1331. gbmam7.seq - Other mammalian sequence entries, part 7. 1332. gbmam8.seq - Other mammalian sequence entries, part 8. 1333. gbnew.txt - Accession numbers of entries new since the previous release. 1334. gbpat1.seq - Patent sequence entries, part 1. 1335. gbpat10.seq - Patent sequence entries, part 10. 1336. gbpat100.seq - Patent sequence entries, part 100. 1337. gbpat101.seq - Patent sequence entries, part 101. 1338. gbpat102.seq - Patent sequence entries, part 102. 1339. gbpat103.seq - Patent sequence entries, part 103. 1340. gbpat104.seq - Patent sequence entries, part 104. 1341. gbpat105.seq - Patent sequence entries, part 105. 1342. gbpat106.seq - Patent sequence entries, part 106. 1343. gbpat107.seq - Patent sequence entries, part 107. 1344. gbpat108.seq - Patent sequence entries, part 108. 1345. gbpat109.seq - Patent sequence entries, part 109. 1346. gbpat11.seq - Patent sequence entries, part 11. 1347. gbpat110.seq - Patent sequence entries, part 110. 1348. gbpat111.seq - Patent sequence entries, part 111. 1349. gbpat112.seq - Patent sequence entries, part 112. 1350. gbpat113.seq - Patent sequence entries, part 113. 1351. gbpat114.seq - Patent sequence entries, part 114. 1352. gbpat115.seq - Patent sequence entries, part 115. 1353. gbpat116.seq - Patent sequence entries, part 116. 1354. gbpat117.seq - Patent sequence entries, part 117. 1355. gbpat118.seq - Patent sequence entries, part 118. 1356. gbpat119.seq - Patent sequence entries, part 119. 1357. gbpat12.seq - Patent sequence entries, part 12. 1358. gbpat120.seq - Patent sequence entries, part 120. 1359. gbpat121.seq - Patent sequence entries, part 121. 1360. gbpat122.seq - Patent sequence entries, part 122. 1361. gbpat123.seq - Patent sequence entries, part 123. 1362. gbpat124.seq - Patent sequence entries, part 124. 1363. gbpat125.seq - Patent sequence entries, part 125. 1364. gbpat126.seq - Patent sequence entries, part 126. 1365. gbpat127.seq - Patent sequence entries, part 127. 1366. gbpat128.seq - Patent sequence entries, part 128. 1367. gbpat129.seq - Patent sequence entries, part 129. 1368. gbpat13.seq - Patent sequence entries, part 13. 1369. gbpat130.seq - Patent sequence entries, part 130. 1370. gbpat131.seq - Patent sequence entries, part 131. 1371. gbpat132.seq - Patent sequence entries, part 132. 1372. gbpat133.seq - Patent sequence entries, part 133. 1373. gbpat134.seq - Patent sequence entries, part 134. 1374. gbpat135.seq - Patent sequence entries, part 135. 1375. gbpat136.seq - Patent sequence entries, part 136. 1376. gbpat137.seq - Patent sequence entries, part 137. 1377. gbpat138.seq - Patent sequence entries, part 138. 1378. gbpat139.seq - Patent sequence entries, part 139. 1379. gbpat14.seq - Patent sequence entries, part 14. 1380. gbpat140.seq - Patent sequence entries, part 140. 1381. gbpat141.seq - Patent sequence entries, part 141. 1382. gbpat142.seq - Patent sequence entries, part 142. 1383. gbpat143.seq - Patent sequence entries, part 143. 1384. gbpat144.seq - Patent sequence entries, part 144. 1385. gbpat145.seq - Patent sequence entries, part 145. 1386. gbpat146.seq - Patent sequence entries, part 146. 1387. gbpat147.seq - Patent sequence entries, part 147. 1388. gbpat148.seq - Patent sequence entries, part 148. 1389. gbpat149.seq - Patent sequence entries, part 149. 1390. gbpat15.seq - Patent sequence entries, part 15. 1391. gbpat150.seq - Patent sequence entries, part 150. 1392. gbpat151.seq - Patent sequence entries, part 151. 1393. gbpat152.seq - Patent sequence entries, part 152. 1394. gbpat153.seq - Patent sequence entries, part 153. 1395. gbpat154.seq - Patent sequence entries, part 154. 1396. gbpat155.seq - Patent sequence entries, part 155. 1397. gbpat156.seq - Patent sequence entries, part 156. 1398. gbpat157.seq - Patent sequence entries, part 157. 1399. gbpat158.seq - Patent sequence entries, part 158. 1400. gbpat159.seq - Patent sequence entries, part 159. 1401. gbpat16.seq - Patent sequence entries, part 16. 1402. gbpat160.seq - Patent sequence entries, part 160. 1403. gbpat161.seq - Patent sequence entries, part 161. 1404. gbpat162.seq - Patent sequence entries, part 162. 1405. gbpat163.seq - Patent sequence entries, part 163. 1406. gbpat164.seq - Patent sequence entries, part 164. 1407. gbpat165.seq - Patent sequence entries, part 165. 1408. gbpat166.seq - Patent sequence entries, part 166. 1409. gbpat167.seq - Patent sequence entries, part 167. 1410. gbpat168.seq - Patent sequence entries, part 168. 1411. gbpat169.seq - Patent sequence entries, part 169. 1412. gbpat17.seq - Patent sequence entries, part 17. 1413. gbpat170.seq - Patent sequence entries, part 170. 1414. gbpat171.seq - Patent sequence entries, part 171. 1415. gbpat172.seq - Patent sequence entries, part 172. 1416. gbpat173.seq - Patent sequence entries, part 173. 1417. gbpat174.seq - Patent sequence entries, part 174. 1418. gbpat175.seq - Patent sequence entries, part 175. 1419. gbpat176.seq - Patent sequence entries, part 176. 1420. gbpat177.seq - Patent sequence entries, part 177. 1421. gbpat178.seq - Patent sequence entries, part 178. 1422. gbpat18.seq - Patent sequence entries, part 18. 1423. gbpat19.seq - Patent sequence entries, part 19. 1424. gbpat2.seq - Patent sequence entries, part 2. 1425. gbpat20.seq - Patent sequence entries, part 20. 1426. gbpat21.seq - Patent sequence entries, part 21. 1427. gbpat22.seq - Patent sequence entries, part 22. 1428. gbpat23.seq - Patent sequence entries, part 23. 1429. gbpat24.seq - Patent sequence entries, part 24. 1430. gbpat25.seq - Patent sequence entries, part 25. 1431. gbpat26.seq - Patent sequence entries, part 26. 1432. gbpat27.seq - Patent sequence entries, part 27. 1433. gbpat28.seq - Patent sequence entries, part 28. 1434. gbpat29.seq - Patent sequence entries, part 29. 1435. gbpat3.seq - Patent sequence entries, part 3. 1436. gbpat30.seq - Patent sequence entries, part 30. 1437. gbpat31.seq - Patent sequence entries, part 31. 1438. gbpat32.seq - Patent sequence entries, part 32. 1439. gbpat33.seq - Patent sequence entries, part 33. 1440. gbpat34.seq - Patent sequence entries, part 34. 1441. gbpat35.seq - Patent sequence entries, part 35. 1442. gbpat36.seq - Patent sequence entries, part 36. 1443. gbpat37.seq - Patent sequence entries, part 37. 1444. gbpat38.seq - Patent sequence entries, part 38. 1445. gbpat39.seq - Patent sequence entries, part 39. 1446. gbpat4.seq - Patent sequence entries, part 4. 1447. gbpat40.seq - Patent sequence entries, part 40. 1448. gbpat41.seq - Patent sequence entries, part 41. 1449. gbpat42.seq - Patent sequence entries, part 42. 1450. gbpat43.seq - Patent sequence entries, part 43. 1451. gbpat44.seq - Patent sequence entries, part 44. 1452. gbpat45.seq - Patent sequence entries, part 45. 1453. gbpat46.seq - Patent sequence entries, part 46. 1454. gbpat47.seq - Patent sequence entries, part 47. 1455. gbpat48.seq - Patent sequence entries, part 48. 1456. gbpat49.seq - Patent sequence entries, part 49. 1457. gbpat5.seq - Patent sequence entries, part 5. 1458. gbpat50.seq - Patent sequence entries, part 50. 1459. gbpat51.seq - Patent sequence entries, part 51. 1460. gbpat52.seq - Patent sequence entries, part 52. 1461. gbpat53.seq - Patent sequence entries, part 53. 1462. gbpat54.seq - Patent sequence entries, part 54. 1463. gbpat55.seq - Patent sequence entries, part 55. 1464. gbpat56.seq - Patent sequence entries, part 56. 1465. gbpat57.seq - Patent sequence entries, part 57. 1466. gbpat58.seq - Patent sequence entries, part 58. 1467. gbpat59.seq - Patent sequence entries, part 59. 1468. gbpat6.seq - Patent sequence entries, part 6. 1469. gbpat60.seq - Patent sequence entries, part 60. 1470. gbpat61.seq - Patent sequence entries, part 61. 1471. gbpat62.seq - Patent sequence entries, part 62. 1472. gbpat63.seq - Patent sequence entries, part 63. 1473. gbpat64.seq - Patent sequence entries, part 64. 1474. gbpat65.seq - Patent sequence entries, part 65. 1475. gbpat66.seq - Patent sequence entries, part 66. 1476. gbpat67.seq - Patent sequence entries, part 67. 1477. gbpat68.seq - Patent sequence entries, part 68. 1478. gbpat69.seq - Patent sequence entries, part 69. 1479. gbpat7.seq - Patent sequence entries, part 7. 1480. gbpat70.seq - Patent sequence entries, part 70. 1481. gbpat71.seq - Patent sequence entries, part 71. 1482. gbpat72.seq - Patent sequence entries, part 72. 1483. gbpat73.seq - Patent sequence entries, part 73. 1484. gbpat74.seq - Patent sequence entries, part 74. 1485. gbpat75.seq - Patent sequence entries, part 75. 1486. gbpat76.seq - Patent sequence entries, part 76. 1487. gbpat77.seq - Patent sequence entries, part 77. 1488. gbpat78.seq - Patent sequence entries, part 78. 1489. gbpat79.seq - Patent sequence entries, part 79. 1490. gbpat8.seq - Patent sequence entries, part 8. 1491. gbpat80.seq - Patent sequence entries, part 80. 1492. gbpat81.seq - Patent sequence entries, part 81. 1493. gbpat82.seq - Patent sequence entries, part 82. 1494. gbpat83.seq - Patent sequence entries, part 83. 1495. gbpat84.seq - Patent sequence entries, part 84. 1496. gbpat85.seq - Patent sequence entries, part 85. 1497. gbpat86.seq - Patent sequence entries, part 86. 1498. gbpat87.seq - Patent sequence entries, part 87. 1499. gbpat88.seq - Patent sequence entries, part 88. 1500. gbpat89.seq - Patent sequence entries, part 89. 1501. gbpat9.seq - Patent sequence entries, part 9. 1502. gbpat90.seq - Patent sequence entries, part 90. 1503. gbpat91.seq - Patent sequence entries, part 91. 1504. gbpat92.seq - Patent sequence entries, part 92. 1505. gbpat93.seq - Patent sequence entries, part 93. 1506. gbpat94.seq - Patent sequence entries, part 94. 1507. gbpat95.seq - Patent sequence entries, part 95. 1508. gbpat96.seq - Patent sequence entries, part 96. 1509. gbpat97.seq - Patent sequence entries, part 97. 1510. gbpat98.seq - Patent sequence entries, part 98. 1511. gbpat99.seq - Patent sequence entries, part 99. 1512. gbphg1.seq - Phage sequence entries, part 1. 1513. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1. 1514. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10. 1515. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11. 1516. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12. 1517. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13. 1518. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14. 1519. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15. 1520. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16. 1521. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17. 1522. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18. 1523. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19. 1524. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2. 1525. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20. 1526. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21. 1527. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22. 1528. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23. 1529. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24. 1530. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25. 1531. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26. 1532. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27. 1533. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28. 1534. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29. 1535. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3. 1536. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30. 1537. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31. 1538. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32. 1539. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33. 1540. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34. 1541. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35. 1542. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36. 1543. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37. 1544. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38. 1545. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39. 1546. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4. 1547. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40. 1548. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41. 1549. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42. 1550. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43. 1551. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44. 1552. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45. 1553. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46. 1554. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47. 1555. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48. 1556. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49. 1557. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5. 1558. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50. 1559. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51. 1560. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52. 1561. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53. 1562. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54. 1563. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55. 1564. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6. 1565. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7. 1566. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8. 1567. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9. 1568. gbpri1.seq - Primate sequence entries, part 1. 1569. gbpri10.seq - Primate sequence entries, part 10. 1570. gbpri11.seq - Primate sequence entries, part 11. 1571. gbpri12.seq - Primate sequence entries, part 12. 1572. gbpri13.seq - Primate sequence entries, part 13. 1573. gbpri14.seq - Primate sequence entries, part 14. 1574. gbpri15.seq - Primate sequence entries, part 15. 1575. gbpri16.seq - Primate sequence entries, part 16. 1576. gbpri17.seq - Primate sequence entries, part 17. 1577. gbpri18.seq - Primate sequence entries, part 18. 1578. gbpri19.seq - Primate sequence entries, part 19. 1579. gbpri2.seq - Primate sequence entries, part 2. 1580. gbpri20.seq - Primate sequence entries, part 20. 1581. gbpri21.seq - Primate sequence entries, part 21. 1582. gbpri22.seq - Primate sequence entries, part 22. 1583. gbpri23.seq - Primate sequence entries, part 23. 1584. gbpri24.seq - Primate sequence entries, part 24. 1585. gbpri25.seq - Primate sequence entries, part 25. 1586. gbpri26.seq - Primate sequence entries, part 26. 1587. gbpri27.seq - Primate sequence entries, part 27. 1588. gbpri28.seq - Primate sequence entries, part 28. 1589. gbpri29.seq - Primate sequence entries, part 29. 1590. gbpri3.seq - Primate sequence entries, part 3. 1591. gbpri30.seq - Primate sequence entries, part 30. 1592. gbpri31.seq - Primate sequence entries, part 31. 1593. gbpri32.seq - Primate sequence entries, part 32. 1594. gbpri33.seq - Primate sequence entries, part 33. 1595. gbpri34.seq - Primate sequence entries, part 34. 1596. gbpri35.seq - Primate sequence entries, part 35. 1597. gbpri36.seq - Primate sequence entries, part 36. 1598. gbpri37.seq - Primate sequence entries, part 37. 1599. gbpri38.seq - Primate sequence entries, part 38. 1600. gbpri39.seq - Primate sequence entries, part 39. 1601. gbpri4.seq - Primate sequence entries, part 4. 1602. gbpri40.seq - Primate sequence entries, part 40. 1603. gbpri41.seq - Primate sequence entries, part 41. 1604. gbpri42.seq - Primate sequence entries, part 42. 1605. gbpri43.seq - Primate sequence entries, part 43. 1606. gbpri44.seq - Primate sequence entries, part 44. 1607. gbpri45.seq - Primate sequence entries, part 45. 1608. gbpri5.seq - Primate sequence entries, part 5. 1609. gbpri6.seq - Primate sequence entries, part 6. 1610. gbpri7.seq - Primate sequence entries, part 7. 1611. gbpri8.seq - Primate sequence entries, part 8. 1612. gbpri9.seq - Primate sequence entries, part 9. 1613. gbrel.txt - Release notes (this document). 1614. gbrod1.seq - Rodent sequence entries, part 1. 1615. gbrod10.seq - Rodent sequence entries, part 10. 1616. gbrod11.seq - Rodent sequence entries, part 11. 1617. gbrod12.seq - Rodent sequence entries, part 12. 1618. gbrod13.seq - Rodent sequence entries, part 13. 1619. gbrod14.seq - Rodent sequence entries, part 14. 1620. gbrod15.seq - Rodent sequence entries, part 15. 1621. gbrod16.seq - Rodent sequence entries, part 16. 1622. gbrod17.seq - Rodent sequence entries, part 17. 1623. gbrod18.seq - Rodent sequence entries, part 18. 1624. gbrod19.seq - Rodent sequence entries, part 19. 1625. gbrod2.seq - Rodent sequence entries, part 2. 1626. gbrod20.seq - Rodent sequence entries, part 20. 1627. gbrod21.seq - Rodent sequence entries, part 21. 1628. gbrod22.seq - Rodent sequence entries, part 22. 1629. gbrod23.seq - Rodent sequence entries, part 23. 1630. gbrod24.seq - Rodent sequence entries, part 24. 1631. gbrod25.seq - Rodent sequence entries, part 25. 1632. gbrod26.seq - Rodent sequence entries, part 26. 1633. gbrod27.seq - Rodent sequence entries, part 27. 1634. gbrod28.seq - Rodent sequence entries, part 28. 1635. gbrod29.seq - Rodent sequence entries, part 29. 1636. gbrod3.seq - Rodent sequence entries, part 3. 1637. gbrod4.seq - Rodent sequence entries, part 4. 1638. gbrod5.seq - Rodent sequence entries, part 5. 1639. gbrod6.seq - Rodent sequence entries, part 6. 1640. gbrod7.seq - Rodent sequence entries, part 7. 1641. gbrod8.seq - Rodent sequence entries, part 8. 1642. gbrod9.seq - Rodent sequence entries, part 9. 1643. gbsdr1.txt - Short directory of the data bank, part 1. 1644. gbsdr2.txt - Short directory of the data bank, part 2. 1645. gbsdr3.txt - Short directory of the data bank, part 3. 1646. gbsec.idx - Index of the entries according to secondary accession number. 1647. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1. 1648. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10. 1649. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11. 1650. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12. 1651. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13. 1652. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14. 1653. gbsts15.seq - STS (sequence tagged site) sequence entries, part 15. 1654. gbsts16.seq - STS (sequence tagged site) sequence entries, part 16. 1655. gbsts17.seq - STS (sequence tagged site) sequence entries, part 17. 1656. gbsts18.seq - STS (sequence tagged site) sequence entries, part 18. 1657. gbsts19.seq - STS (sequence tagged site) sequence entries, part 19. 1658. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2. 1659. gbsts20.seq - STS (sequence tagged site) sequence entries, part 20. 1660. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3. 1661. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4. 1662. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5. 1663. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6. 1664. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7. 1665. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8. 1666. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9. 1667. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1. 1668. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2. 1669. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3. 1670. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4. 1671. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5. 1672. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6. 1673. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7. 1674. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1. 1675. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10. 1676. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11. 1677. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12. 1678. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13. 1679. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14. 1680. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15. 1681. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16. 1682. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17. 1683. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18. 1684. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19. 1685. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2. 1686. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20. 1687. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21. 1688. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22. 1689. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23. 1690. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24. 1691. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25. 1692. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26. 1693. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27. 1694. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28. 1695. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29. 1696. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3. 1697. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30. 1698. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31. 1699. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32. 1700. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33. 1701. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34. 1702. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35. 1703. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36. 1704. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37. 1705. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38. 1706. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39. 1707. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4. 1708. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40. 1709. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41. 1710. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42. 1711. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43. 1712. gbtsa44.seq - TSA (transcriptome shotgun assembly) sequence entries, part 44. 1713. gbtsa45.seq - TSA (transcriptome shotgun assembly) sequence entries, part 45. 1714. gbtsa46.seq - TSA (transcriptome shotgun assembly) sequence entries, part 46. 1715. gbtsa47.seq - TSA (transcriptome shotgun assembly) sequence entries, part 47. 1716. gbtsa48.seq - TSA (transcriptome shotgun assembly) sequence entries, part 48. 1717. gbtsa49.seq - TSA (transcriptome shotgun assembly) sequence entries, part 49. 1718. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5. 1719. gbtsa50.seq - TSA (transcriptome shotgun assembly) sequence entries, part 50. 1720. gbtsa51.seq - TSA (transcriptome shotgun assembly) sequence entries, part 51. 1721. gbtsa52.seq - TSA (transcriptome shotgun assembly) sequence entries, part 52. 1722. gbtsa53.seq - TSA (transcriptome shotgun assembly) sequence entries, part 53. 1723. gbtsa54.seq - TSA (transcriptome shotgun assembly) sequence entries, part 54. 1724. gbtsa55.seq - TSA (transcriptome shotgun assembly) sequence entries, part 55. 1725. gbtsa56.seq - TSA (transcriptome shotgun assembly) sequence entries, part 56. 1726. gbtsa57.seq - TSA (transcriptome shotgun assembly) sequence entries, part 57. 1727. gbtsa58.seq - TSA (transcriptome shotgun assembly) sequence entries, part 58. 1728. gbtsa59.seq - TSA (transcriptome shotgun assembly) sequence entries, part 59. 1729. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6. 1730. gbtsa60.seq - TSA (transcriptome shotgun assembly) sequence entries, part 60. 1731. gbtsa61.seq - TSA (transcriptome shotgun assembly) sequence entries, part 61. 1732. gbtsa62.seq - TSA (transcriptome shotgun assembly) sequence entries, part 62. 1733. gbtsa63.seq - TSA (transcriptome shotgun assembly) sequence entries, part 63. 1734. gbtsa64.seq - TSA (transcriptome shotgun assembly) sequence entries, part 64. 1735. gbtsa65.seq - TSA (transcriptome shotgun assembly) sequence entries, part 65. 1736. gbtsa66.seq - TSA (transcriptome shotgun assembly) sequence entries, part 66. 1737. gbtsa67.seq - TSA (transcriptome shotgun assembly) sequence entries, part 67. 1738. gbtsa68.seq - TSA (transcriptome shotgun assembly) sequence entries, part 68. 1739. gbtsa69.seq - TSA (transcriptome shotgun assembly) sequence entries, part 69. 1740. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7. 1741. gbtsa70.seq - TSA (transcriptome shotgun assembly) sequence entries, part 70. 1742. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8. 1743. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9. 1744. gbuna1.seq - Unannotated sequence entries, part 1. 1745. gbvrl1.seq - Viral sequence entries, part 1. 1746. gbvrl10.seq - Viral sequence entries, part 10. 1747. gbvrl11.seq - Viral sequence entries, part 11. 1748. gbvrl12.seq - Viral sequence entries, part 12. 1749. gbvrl13.seq - Viral sequence entries, part 13. 1750. gbvrl14.seq - Viral sequence entries, part 14. 1751. gbvrl15.seq - Viral sequence entries, part 15. 1752. gbvrl16.seq - Viral sequence entries, part 16. 1753. gbvrl17.seq - Viral sequence entries, part 17. 1754. gbvrl18.seq - Viral sequence entries, part 18. 1755. gbvrl19.seq - Viral sequence entries, part 19. 1756. gbvrl2.seq - Viral sequence entries, part 2. 1757. gbvrl20.seq - Viral sequence entries, part 20. 1758. gbvrl3.seq - Viral sequence entries, part 3. 1759. gbvrl4.seq - Viral sequence entries, part 4. 1760. gbvrl5.seq - Viral sequence entries, part 5. 1761. gbvrl6.seq - Viral sequence entries, part 6. 1762. gbvrl7.seq - Viral sequence entries, part 7. 1763. gbvrl8.seq - Viral sequence entries, part 8. 1764. gbvrl9.seq - Viral sequence entries, part 9. 1765. gbvrt1.seq - Other vertebrate sequence entries, part 1. 1766. gbvrt10.seq - Other vertebrate sequence entries, part 10. 1767. gbvrt11.seq - Other vertebrate sequence entries, part 11. 1768. gbvrt12.seq - Other vertebrate sequence entries, part 12. 1769. gbvrt13.seq - Other vertebrate sequence entries, part 13. 1770. gbvrt14.seq - Other vertebrate sequence entries, part 14. 1771. gbvrt15.seq - Other vertebrate sequence entries, part 15. 1772. gbvrt16.seq - Other vertebrate sequence entries, part 16. 1773. gbvrt17.seq - Other vertebrate sequence entries, part 17. 1774. gbvrt18.seq - Other vertebrate sequence entries, part 18. 1775. gbvrt19.seq - Other vertebrate sequence entries, part 19. 1776. gbvrt2.seq - Other vertebrate sequence entries, part 2. 1777. gbvrt20.seq - Other vertebrate sequence entries, part 20. 1778. gbvrt21.seq - Other vertebrate sequence entries, part 21. 1779. gbvrt22.seq - Other vertebrate sequence entries, part 22. 1780. gbvrt23.seq - Other vertebrate sequence entries, part 23. 1781. gbvrt24.seq - Other vertebrate sequence entries, part 24. 1782. gbvrt25.seq - Other vertebrate sequence entries, part 25. 1783. gbvrt26.seq - Other vertebrate sequence entries, part 26. 1784. gbvrt3.seq - Other vertebrate sequence entries, part 3. 1785. gbvrt4.seq - Other vertebrate sequence entries, part 4. 1786. gbvrt5.seq - Other vertebrate sequence entries, part 5. 1787. gbvrt6.seq - Other vertebrate sequence entries, part 6. 1788. gbvrt7.seq - Other vertebrate sequence entries, part 7. 1789. gbvrt8.seq - Other vertebrate sequence entries, part 8. 1790. gbvrt9.seq - Other vertebrate sequence entries, part 9. Sequences in the CON division data files (gbcon*.seq) are constructed from other "traditional" sequence records, and are represented in a unique way. CON records do not contain any sequence data; instead, they utilize a CONTIG linetype with a join() statement which describes how component sequences can be assembled to form the larger constructed sequence. Records in the CON division do not contribute to GenBank Release statistics (Sections 2.2.6, 2.2.7, and 2.2.8), or to the overall release statistics presented in the header of these release notes. The GenBank README describes the CON division of GenBank in more detail: ftp://ftp.ncbi.nih.gov/genbank/README.genbank 2.2.5 File Sizes Uncompressed, the Release 189.0 flatfiles require roughly 545 GB (sequence files only) or 586 GB (including the 'short directory', 'index' and the *.txt files). The following table contains the approximate sizes of the individual files in this release. Since minor changes to some of the files might have occurred after these release notes were written, these sizes should not be used to determine file integrity; they are provided as an aid to planning only. File Size File Name 1992103018 gbacc1.idx 2393141685 gbacc2.idx 845916231 gbacc3.idx 183987859 gbaut1.idx 186090645 gbaut10.idx 186060262 gbaut11.idx 184271344 gbaut12.idx 250584891 gbaut13.idx 183902984 gbaut14.idx 186755583 gbaut15.idx 188375618 gbaut16.idx 234847560 gbaut17.idx 187030523 gbaut18.idx 188907466 gbaut19.idx 247761002 gbaut2.idx 185023067 gbaut20.idx 250122200 gbaut21.idx 230209356 gbaut22.idx 187695199 gbaut23.idx 188782709 gbaut24.idx 201508914 gbaut25.idx 241060510 gbaut26.idx 185843220 gbaut27.idx 184606016 gbaut28.idx 184077621 gbaut29.idx 220840469 gbaut3.idx 183955073 gbaut30.idx 184001803 gbaut31.idx 184524119 gbaut32.idx 185845670 gbaut33.idx 183800094 gbaut34.idx 207855256 gbaut35.idx 188655558 gbaut36.idx 183938245 gbaut37.idx 192847440 gbaut38.idx 183970959 gbaut39.idx 183950020 gbaut4.idx 183893885 gbaut40.idx 183948601 gbaut41.idx 185960623 gbaut42.idx 185541308 gbaut43.idx 192412762 gbaut44.idx 250820422 gbaut45.idx 207504576 gbaut46.idx 188755028 gbaut47.idx 199158863 gbaut48.idx 190385798 gbaut49.idx 243347491 gbaut5.idx 202993617 gbaut50.idx 232486458 gbaut51.idx 186869098 gbaut52.idx 184287318 gbaut53.idx 183898075 gbaut54.idx 184025803 gbaut55.idx 185823112 gbaut56.idx 224055967 gbaut57.idx 186047565 gbaut58.idx 185212585 gbaut59.idx 200283326 gbaut6.idx 184042509 gbaut60.idx 185688569 gbaut61.idx 183860697 gbaut62.idx 188071738 gbaut63.idx 185804331 gbaut64.idx 240069295 gbaut65.idx 189901689 gbaut66.idx 185254279 gbaut67.idx 186019011 gbaut68.idx 183940699 gbaut69.idx 184148093 gbaut7.idx 184788998 gbaut70.idx 186493825 gbaut71.idx 187137281 gbaut72.idx 184694322 gbaut73.idx 186255499 gbaut74.idx 187741906 gbaut75.idx 185954406 gbaut76.idx 219719889 gbaut77.idx 184673368 gbaut78.idx 185346028 gbaut79.idx 188537898 gbaut8.idx 191861059 gbaut80.idx 183904094 gbaut81.idx 184524770 gbaut82.idx 184294509 gbaut83.idx 184509475 gbaut84.idx 244979657 gbaut85.idx 184956702 gbaut86.idx 185149283 gbaut87.idx 183788052 gbaut88.idx 185617183 gbaut89.idx 196458144 gbaut9.idx 184412369 gbaut90.idx 194570681 gbaut91.idx 184651361 gbaut92.idx 183863734 gbaut93.idx 209997120 gbaut94.idx 183952573 gbaut95.idx 187119204 gbaut96.idx 31809183 gbaut97.idx 249999222 gbbct1.seq 244870852 gbbct10.seq 244613667 gbbct11.seq 236598271 gbbct12.seq 250000111 gbbct13.seq 30699010 gbbct14.seq 243165286 gbbct15.seq 249783326 gbbct16.seq 245551992 gbbct17.seq 248628765 gbbct18.seq 248242091 gbbct19.seq 245372753 gbbct2.seq 249281961 gbbct20.seq 246198630 gbbct21.seq 245693356 gbbct22.seq 217806784 gbbct23.seq 242803771 gbbct24.seq 241840999 gbbct25.seq 248677048 gbbct26.seq 247875345 gbbct27.seq 249388245 gbbct28.seq 244185977 gbbct29.seq 247570684 gbbct3.seq 247336992 gbbct30.seq 249996799 gbbct31.seq 249761445 gbbct32.seq 249790948 gbbct33.seq 242886336 gbbct34.seq 241625881 gbbct35.seq 160068904 gbbct36.seq 243880501 gbbct37.seq 246111304 gbbct38.seq 242768074 gbbct39.seq 241184574 gbbct4.seq 239636196 gbbct40.seq 247210305 gbbct41.seq 246790666 gbbct42.seq 245870812 gbbct43.seq 244913595 gbbct44.seq 248036754 gbbct45.seq 248281460 gbbct46.seq 241195587 gbbct47.seq 162003991 gbbct48.seq 249923106 gbbct49.seq 213978084 gbbct5.seq 247105195 gbbct50.seq 241662934 gbbct51.seq 245557638 gbbct52.seq 246292986 gbbct53.seq 246413424 gbbct54.seq 249774041 gbbct55.seq 247796112 gbbct56.seq 248838160 gbbct57.seq 244464112 gbbct58.seq 243118318 gbbct59.seq 242133044 gbbct6.seq 198928158 gbbct60.seq 245006659 gbbct61.seq 247398154 gbbct62.seq 249964013 gbbct63.seq 246718647 gbbct64.seq 145949622 gbbct65.seq 6887681 gbbct66.seq 14096568 gbbct67.seq 23201077 gbbct68.seq 45100970 gbbct69.seq 248056375 gbbct7.seq 87782672 gbbct70.seq 170071264 gbbct71.seq 249999413 gbbct72.seq 249998793 gbbct73.seq 243633457 gbbct74.seq 249784623 gbbct75.seq 241414051 gbbct76.seq 247359815 gbbct77.seq 249997476 gbbct78.seq 249773683 gbbct79.seq 247183485 gbbct8.seq 78703112 gbbct80.seq 249769426 gbbct81.seq 249999929 gbbct82.seq 249997613 gbbct83.seq 249995007 gbbct84.seq 112611248 gbbct85.seq 245011144 gbbct9.seq 12439594 gbchg.txt 249998437 gbcon1.seq 249997306 gbcon10.seq 249994223 gbcon100.seq 249995660 gbcon101.seq 249998605 gbcon102.seq 249998936 gbcon103.seq 250000223 gbcon104.seq 156342446 gbcon105.seq 249996812 gbcon106.seq 249993767 gbcon107.seq 249992301 gbcon108.seq 249998322 gbcon109.seq 249367269 gbcon11.seq 71615782 gbcon110.seq 212826019 gbcon111.seq 250000256 gbcon112.seq 250000098 gbcon113.seq 249995503 gbcon114.seq 249983740 gbcon115.seq 109734089 gbcon116.seq 249914315 gbcon117.seq 249999105 gbcon118.seq 180025678 gbcon119.seq 248928386 gbcon12.seq 249997285 gbcon120.seq 250000198 gbcon121.seq 249998745 gbcon122.seq 222475340 gbcon123.seq 248981147 gbcon124.seq 249952905 gbcon125.seq 249856157 gbcon126.seq 249994853 gbcon127.seq 249998775 gbcon128.seq 249998332 gbcon129.seq 249414427 gbcon13.seq 26893749 gbcon130.seq 249978699 gbcon131.seq 249998490 gbcon132.seq 249993348 gbcon133.seq 249999880 gbcon134.seq 249912502 gbcon135.seq 249948624 gbcon136.seq 249955490 gbcon137.seq 233498612 gbcon138.seq 246632492 gbcon139.seq 249998181 gbcon14.seq 247088480 gbcon140.seq 249512645 gbcon141.seq 249992268 gbcon142.seq 108787033 gbcon143.seq 249998195 gbcon144.seq 249695087 gbcon145.seq 249996033 gbcon146.seq 249963114 gbcon147.seq 250000246 gbcon148.seq 249792074 gbcon149.seq 46257922 gbcon15.seq 249955090 gbcon150.seq 249999017 gbcon151.seq 199658550 gbcon152.seq 249970974 gbcon153.seq 249999146 gbcon154.seq 249995739 gbcon155.seq 249929876 gbcon156.seq 249999580 gbcon157.seq 130279337 gbcon158.seq 250000007 gbcon159.seq 247404331 gbcon16.seq 249955167 gbcon160.seq 249997423 gbcon161.seq 249998688 gbcon162.seq 250000092 gbcon163.seq 249668804 gbcon164.seq 249998963 gbcon165.seq 95920969 gbcon166.seq 18856115 gbcon167.seq 249996913 gbcon17.seq 249931945 gbcon18.seq 45091689 gbcon19.seq 249930528 gbcon2.seq 249999960 gbcon20.seq 249360219 gbcon21.seq 116173132 gbcon22.seq 249999462 gbcon23.seq 120041874 gbcon24.seq 249996870 gbcon25.seq 249724019 gbcon26.seq 249997572 gbcon27.seq 249998238 gbcon28.seq 186471574 gbcon29.seq 248161967 gbcon3.seq 249999756 gbcon30.seq 249997224 gbcon31.seq 249999813 gbcon32.seq 249999952 gbcon33.seq 247997550 gbcon34.seq 232565070 gbcon35.seq 249999237 gbcon36.seq 249996869 gbcon37.seq 249995921 gbcon38.seq 249996351 gbcon39.seq 248979371 gbcon4.seq 249999450 gbcon40.seq 249997210 gbcon41.seq 61183731 gbcon42.seq 249997486 gbcon43.seq 249994070 gbcon44.seq 249999391 gbcon45.seq 249997743 gbcon46.seq 249994859 gbcon47.seq 43089049 gbcon48.seq 249993995 gbcon49.seq 249999843 gbcon5.seq 249996310 gbcon50.seq 249994442 gbcon51.seq 249997248 gbcon52.seq 250000078 gbcon53.seq 36404971 gbcon54.seq 249993185 gbcon55.seq 249998119 gbcon56.seq 249995170 gbcon57.seq 249998154 gbcon58.seq 249998078 gbcon59.seq 249993449 gbcon6.seq 152679523 gbcon60.seq 249999955 gbcon61.seq 249999066 gbcon62.seq 249997558 gbcon63.seq 249998625 gbcon64.seq 183609322 gbcon65.seq 249999870 gbcon66.seq 249997967 gbcon67.seq 249997138 gbcon68.seq 249995207 gbcon69.seq 231272949 gbcon7.seq 245488804 gbcon70.seq 250000182 gbcon71.seq 249998695 gbcon72.seq 249998372 gbcon73.seq 249996966 gbcon74.seq 250000007 gbcon75.seq 96627683 gbcon76.seq 249993448 gbcon77.seq 249995119 gbcon78.seq 249997383 gbcon79.seq 249997708 gbcon8.seq 249995948 gbcon80.seq 249999042 gbcon81.seq 62682749 gbcon82.seq 249997771 gbcon83.seq 249996653 gbcon84.seq 249999445 gbcon85.seq 249999590 gbcon86.seq 249998149 gbcon87.seq 21674116 gbcon88.seq 249998140 gbcon89.seq 249996514 gbcon9.seq 249997503 gbcon90.seq 249996940 gbcon91.seq 249995720 gbcon92.seq 197881888 gbcon93.seq 249993974 gbcon94.seq 249996060 gbcon95.seq 249999726 gbcon96.seq 249998645 gbcon97.seq 249996901 gbcon98.seq 133265984 gbcon99.seq 5226689 gbdel.txt 249998126 gbenv1.seq 249999987 gbenv10.seq 56473734 gbenv11.seq 249999616 gbenv12.seq 249999595 gbenv13.seq 249997680 gbenv14.seq 249999723 gbenv15.seq 249998637 gbenv16.seq 249999240 gbenv17.seq 249996520 gbenv18.seq 201131266 gbenv19.seq 249999695 gbenv2.seq 249997542 gbenv20.seq 250000045 gbenv21.seq 249998701 gbenv22.seq 249999056 gbenv23.seq 156286621 gbenv24.seq 249998724 gbenv25.seq 249965280 gbenv26.seq 249999705 gbenv27.seq 249999280 gbenv28.seq 249999160 gbenv29.seq 250000121 gbenv3.seq 154215264 gbenv30.seq 249998069 gbenv31.seq 249997320 gbenv32.seq 249998597 gbenv33.seq 249999542 gbenv34.seq 142451829 gbenv35.seq 249999327 gbenv36.seq 249999297 gbenv37.seq 249999340 gbenv38.seq 249998563 gbenv39.seq 249997874 gbenv4.seq 249998831 gbenv40.seq 226946874 gbenv41.seq 249999751 gbenv42.seq 249998764 gbenv43.seq 250000028 gbenv44.seq 249999389 gbenv45.seq 80801262 gbenv46.seq 249996327 gbenv47.seq 249996957 gbenv48.seq 249997170 gbenv49.seq 249999153 gbenv5.seq 249997321 gbenv50.seq 249999151 gbenv51.seq 249998084 gbenv52.seq 19654377 gbenv53.seq 241051428 gbenv6.seq 249998471 gbenv7.seq 249999917 gbenv8.seq 249998584 gbenv9.seq 524292008 gbest1.seq 524289016 gbest10.seq 524291268 gbest100.seq 524289437 gbest101.seq 524290715 gbest102.seq 524289086 gbest103.seq 349471723 gbest104.seq 524291148 gbest105.seq 524289738 gbest106.seq 524291194 gbest107.seq 385839175 gbest108.seq 389670817 gbest109.seq 524290986 gbest11.seq 383425467 gbest110.seq 384188998 gbest111.seq 381057139 gbest112.seq 385305672 gbest113.seq 390039961 gbest114.seq 388178589 gbest115.seq 387308759 gbest116.seq 383862694 gbest117.seq 407500455 gbest118.seq 510284736 gbest119.seq 524288931 gbest12.seq 524288993 gbest120.seq 524289609 gbest121.seq 524290228 gbest122.seq 524290198 gbest123.seq 431202902 gbest124.seq 524290226 gbest125.seq 524292007 gbest126.seq 524289559 gbest127.seq 524289933 gbest128.seq 524292165 gbest129.seq 156583008 gbest13.seq 524290205 gbest130.seq 524288969 gbest131.seq 524290499 gbest132.seq 524289594 gbest133.seq 524291657 gbest134.seq 524289466 gbest135.seq 524289777 gbest136.seq 299948048 gbest137.seq 524290906 gbest138.seq 524291320 gbest139.seq 524289786 gbest14.seq 524292469 gbest140.seq 524291268 gbest141.seq 524292303 gbest142.seq 524289908 gbest143.seq 524289804 gbest144.seq 524290725 gbest145.seq 524289388 gbest146.seq 524288942 gbest147.seq 524289469 gbest148.seq 524291987 gbest149.seq 524291437 gbest15.seq 524289983 gbest150.seq 464599767 gbest151.seq 524291621 gbest152.seq 524289898 gbest153.seq 524290313 gbest154.seq 524291048 gbest155.seq 524289615 gbest156.seq 524288756 gbest157.seq 524289333 gbest158.seq 524292205 gbest159.seq 524289246 gbest16.seq 524289298 gbest160.seq 524292946 gbest161.seq 524288923 gbest162.seq 524288941 gbest163.seq 244792923 gbest164.seq 524290553 gbest165.seq 524290082 gbest166.seq 524291149 gbest167.seq 524291109 gbest168.seq 524290549 gbest169.seq 524289351 gbest17.seq 524289746 gbest170.seq 524290294 gbest171.seq 524289737 gbest172.seq 524289426 gbest173.seq 524289043 gbest174.seq 524290997 gbest175.seq 524290710 gbest176.seq 524289416 gbest177.seq 112726770 gbest178.seq 524289455 gbest179.seq 524290027 gbest18.seq 524290176 gbest180.seq 524289972 gbest181.seq 524291308 gbest182.seq 524288814 gbest183.seq 524290837 gbest184.seq 524290819 gbest185.seq 524289479 gbest186.seq 524289157 gbest187.seq 524291338 gbest188.seq 524288746 gbest189.seq 524291602 gbest19.seq 524288754 gbest190.seq 467977833 gbest191.seq 524290972 gbest192.seq 524290099 gbest193.seq 524290680 gbest194.seq 524292662 gbest195.seq 524289242 gbest196.seq 524289152 gbest197.seq 524289984 gbest198.seq 524290974 gbest199.seq 524289694 gbest2.seq 524289794 gbest20.seq 524289613 gbest200.seq 524289209 gbest201.seq 524290559 gbest202.seq 524289133 gbest203.seq 524291398 gbest204.seq 83759466 gbest205.seq 524289587 gbest206.seq 524288736 gbest207.seq 524289118 gbest208.seq 524289225 gbest209.seq 524291555 gbest21.seq 524291008 gbest210.seq 524290107 gbest211.seq 524291006 gbest212.seq 524290702 gbest213.seq 524288823 gbest214.seq 524289838 gbest215.seq 421982696 gbest216.seq 524292573 gbest217.seq 524291705 gbest218.seq 524288981 gbest219.seq 512090321 gbest22.seq 524290993 gbest220.seq 524291112 gbest221.seq 524294808 gbest222.seq 524289268 gbest223.seq 524291819 gbest224.seq 524290881 gbest225.seq 524289350 gbest226.seq 524290342 gbest227.seq 524291126 gbest228.seq 524291154 gbest229.seq 500344147 gbest23.seq 351153673 gbest230.seq 524291828 gbest231.seq 524290256 gbest232.seq 524289759 gbest233.seq 524293306 gbest234.seq 524292254 gbest235.seq 524290349 gbest236.seq 524293292 gbest237.seq 524290432 gbest238.seq 524291590 gbest239.seq 509304525 gbest24.seq 524291065 gbest240.seq 524290788 gbest241.seq 524289177 gbest242.seq 524290253 gbest243.seq 524290415 gbest244.seq 49001491 gbest245.seq 524288751 gbest246.seq 524289516 gbest247.seq 524292105 gbest248.seq 524288902 gbest249.seq 319590070 gbest25.seq 524290050 gbest250.seq 524289119 gbest251.seq 524289777 gbest252.seq 524291413 gbest253.seq 524289460 gbest254.seq 524289663 gbest255.seq 524291724 gbest256.seq 260104720 gbest257.seq 524289994 gbest258.seq 524290112 gbest259.seq 524288828 gbest26.seq 524289510 gbest260.seq 524290027 gbest261.seq 524289945 gbest262.seq 524290744 gbest263.seq 524288967 gbest264.seq 524290443 gbest265.seq 524290316 gbest266.seq 524290430 gbest267.seq 297070339 gbest268.seq 524288751 gbest269.seq 524290412 gbest27.seq 524288830 gbest270.seq 524289356 gbest271.seq 524291720 gbest272.seq 524289115 gbest273.seq 524289389 gbest274.seq 524288772 gbest275.seq 524290550 gbest276.seq 524289620 gbest277.seq 524289992 gbest278.seq 524289409 gbest279.seq 524288758 gbest28.seq 302513707 gbest280.seq 524293416 gbest281.seq 524290544 gbest282.seq 524289704 gbest283.seq 524290519 gbest284.seq 524289514 gbest285.seq 524289433 gbest286.seq 524289863 gbest287.seq 524290574 gbest288.seq 524292530 gbest289.seq 524290753 gbest29.seq 524289853 gbest290.seq 524288759 gbest291.seq 230059846 gbest292.seq 524290964 gbest293.seq 524290663 gbest294.seq 524289307 gbest295.seq 524291130 gbest296.seq 524291216 gbest297.seq 524288935 gbest298.seq 524290523 gbest299.seq 497701912 gbest3.seq 524290738 gbest30.seq 524288772 gbest300.seq 477427193 gbest301.seq 485390008 gbest302.seq 487642595 gbest303.seq 320271085 gbest304.seq 524290048 gbest305.seq 524289871 gbest306.seq 524289378 gbest307.seq 524289530 gbest308.seq 524290042 gbest309.seq 524290199 gbest31.seq 524290258 gbest310.seq 524290274 gbest311.seq 524290889 gbest312.seq 524291644 gbest313.seq 524289301 gbest314.seq 524288916 gbest315.seq 524291749 gbest316.seq 497575917 gbest317.seq 524289299 gbest318.seq 524290548 gbest319.seq 524291145 gbest32.seq 524290184 gbest320.seq 524289957 gbest321.seq 524292539 gbest322.seq 524289872 gbest323.seq 524288956 gbest324.seq 524290991 gbest325.seq 524290627 gbest326.seq 524118653 gbest327.seq 524289685 gbest328.seq 524291318 gbest329.seq 524289323 gbest33.seq 524290569 gbest330.seq 250338987 gbest331.seq 524290455 gbest332.seq 524289770 gbest333.seq 524290662 gbest334.seq 524293472 gbest335.seq 501685245 gbest336.seq 524292606 gbest337.seq 524290450 gbest338.seq 524291819 gbest339.seq 519566956 gbest34.seq 524289116 gbest340.seq 524289345 gbest341.seq 524292325 gbest342.seq 524289433 gbest343.seq 524289249 gbest344.seq 342088864 gbest345.seq 524292213 gbest346.seq 524290831 gbest347.seq 524289370 gbest348.seq 524290335 gbest349.seq 492730500 gbest35.seq 524290773 gbest350.seq 524290880 gbest351.seq 524290558 gbest352.seq 524288833 gbest353.seq 524292507 gbest354.seq 524289430 gbest355.seq 524289104 gbest356.seq 524288900 gbest357.seq 524291932 gbest358.seq 524290462 gbest359.seq 494451765 gbest36.seq 16502264 gbest360.seq 524290373 gbest361.seq 524289513 gbest362.seq 524291941 gbest363.seq 524292678 gbest364.seq 524290541 gbest365.seq 524290060 gbest366.seq 524289377 gbest367.seq 524289351 gbest368.seq 524291276 gbest369.seq 493340572 gbest37.seq 524289106 gbest370.seq 386240288 gbest371.seq 524289612 gbest372.seq 524289110 gbest373.seq 524289755 gbest374.seq 505509793 gbest375.seq 524289509 gbest376.seq 524291315 gbest377.seq 524291404 gbest378.seq 524291214 gbest379.seq 488000483 gbest38.seq 524289505 gbest380.seq 524291322 gbest381.seq 524290565 gbest382.seq 354341025 gbest383.seq 524291127 gbest384.seq 524289482 gbest385.seq 524289915 gbest386.seq 524291218 gbest387.seq 524290453 gbest388.seq 524292363 gbest389.seq 493252495 gbest39.seq 524288764 gbest390.seq 524290144 gbest391.seq 524290932 gbest392.seq 524289330 gbest393.seq 524290342 gbest394.seq 185097263 gbest395.seq 524292162 gbest396.seq 524291056 gbest397.seq 524288912 gbest398.seq 524290219 gbest399.seq 524288944 gbest4.seq 111460427 gbest40.seq 524290838 gbest400.seq 524292071 gbest401.seq 524288841 gbest402.seq 524289363 gbest403.seq 524291329 gbest404.seq 524291661 gbest405.seq 524291155 gbest406.seq 524289864 gbest407.seq 485613512 gbest408.seq 524290761 gbest409.seq 524294013 gbest41.seq 524289578 gbest410.seq 524289089 gbest411.seq 524289797 gbest412.seq 524288959 gbest413.seq 524290418 gbest414.seq 524290592 gbest415.seq 524289240 gbest416.seq 524290163 gbest417.seq 524291589 gbest418.seq 524289635 gbest419.seq 524292378 gbest42.seq 524290071 gbest420.seq 524291541 gbest421.seq 19587268 gbest422.seq 524290635 gbest423.seq 524290812 gbest424.seq 524291282 gbest425.seq 524290169 gbest426.seq 524292260 gbest427.seq 524290775 gbest428.seq 524290919 gbest429.seq 524291152 gbest43.seq 524290073 gbest430.seq 524290231 gbest431.seq 524290589 gbest432.seq 524290117 gbest433.seq 524290183 gbest434.seq 524288838 gbest435.seq 524290267 gbest436.seq 25342560 gbest437.seq 524290097 gbest438.seq 524289139 gbest439.seq 524291994 gbest44.seq 524289291 gbest440.seq 524290687 gbest441.seq 524291641 gbest442.seq 524292107 gbest443.seq 524289173 gbest444.seq 524291054 gbest445.seq 524290278 gbest446.seq 524290005 gbest447.seq 524290827 gbest448.seq 357942556 gbest449.seq 524289744 gbest45.seq 524289991 gbest450.seq 524289686 gbest451.seq 524290075 gbest452.seq 524290204 gbest453.seq 524290572 gbest454.seq 524289962 gbest455.seq 524289235 gbest456.seq 524292356 gbest457.seq 524290358 gbest458.seq 524289760 gbest459.seq 524290536 gbest46.seq 524289164 gbest460.seq 135655340 gbest461.seq 524290443 gbest47.seq 524289407 gbest48.seq 524288743 gbest49.seq 524289625 gbest5.seq 524289597 gbest50.seq 524290850 gbest51.seq 524290902 gbest52.seq 524291426 gbest53.seq 253754987 gbest54.seq 524289855 gbest55.seq 524292065 gbest56.seq 524288912 gbest57.seq 524289072 gbest58.seq 524289254 gbest59.seq 524288762 gbest6.seq 524290970 gbest60.seq 524291770 gbest61.seq 524291036 gbest62.seq 524290524 gbest63.seq 524290125 gbest64.seq 524291456 gbest65.seq 524289317 gbest66.seq 463063233 gbest67.seq 524293061 gbest68.seq 524289120 gbest69.seq 524290014 gbest7.seq 524290220 gbest70.seq 524288927 gbest71.seq 524291051 gbest72.seq 524292401 gbest73.seq 524290703 gbest74.seq 524289284 gbest75.seq 524288986 gbest76.seq 524291000 gbest77.seq 524290955 gbest78.seq 524291491 gbest79.seq 524290628 gbest8.seq 190810938 gbest80.seq 524290100 gbest81.seq 524289613 gbest82.seq 524289693 gbest83.seq 524288728 gbest84.seq 524289166 gbest85.seq 524292117 gbest86.seq 524291563 gbest87.seq 524291075 gbest88.seq 524290998 gbest89.seq 524289667 gbest9.seq 524290258 gbest90.seq 524290235 gbest91.seq 462469660 gbest92.seq 524291760 gbest93.seq 524292054 gbest94.seq 524291571 gbest95.seq 524289444 gbest96.seq 524290291 gbest97.seq 524292097 gbest98.seq 524290031 gbest99.seq 182899103 gbgen.idx 524290352 gbgss1.seq 524292173 gbgss10.seq 524292593 gbgss100.seq 524289703 gbgss101.seq 524291138 gbgss102.seq 524290642 gbgss103.seq 418354153 gbgss104.seq 524290801 gbgss105.seq 524290070 gbgss106.seq 524290718 gbgss107.seq 524288733 gbgss108.seq 524288767 gbgss109.seq 524291375 gbgss11.seq 524289084 gbgss110.seq 524290809 gbgss111.seq 524289971 gbgss112.seq 524291028 gbgss113.seq 524291069 gbgss114.seq 524289142 gbgss115.seq 55578194 gbgss116.seq 524289697 gbgss117.seq 524288912 gbgss118.seq 524289210 gbgss119.seq 524290109 gbgss12.seq 524289140 gbgss120.seq 524290583 gbgss121.seq 524289663 gbgss122.seq 524289754 gbgss123.seq 524289869 gbgss124.seq 524290826 gbgss125.seq 524289574 gbgss126.seq 524289664 gbgss127.seq 524289492 gbgss128.seq 212391980 gbgss129.seq 524289051 gbgss13.seq 524289179 gbgss130.seq 524289525 gbgss131.seq 524289495 gbgss132.seq 524291043 gbgss133.seq 524288845 gbgss134.seq 524291036 gbgss135.seq 524292513 gbgss136.seq 524288848 gbgss137.seq 524289263 gbgss138.seq 515991481 gbgss139.seq 524289106 gbgss14.seq 516018273 gbgss140.seq 112014629 gbgss141.seq 524289872 gbgss142.seq 524291315 gbgss143.seq 524290675 gbgss144.seq 524290093 gbgss145.seq 524290136 gbgss146.seq 524291253 gbgss147.seq 524290973 gbgss148.seq 524290456 gbgss149.seq 524290836 gbgss15.seq 524289948 gbgss150.seq 524289018 gbgss151.seq 205352039 gbgss152.seq 249997495 gbgss153.seq 249999691 gbgss154.seq 249999296 gbgss155.seq 249999790 gbgss156.seq 28694264 gbgss157.seq 249997137 gbgss158.seq 250000033 gbgss159.seq 524290486 gbgss16.seq 249998542 gbgss160.seq 249998333 gbgss161.seq 224919493 gbgss162.seq 249998415 gbgss163.seq 249998761 gbgss164.seq 249998880 gbgss165.seq 249998175 gbgss166.seq 190065974 gbgss167.seq 249999433 gbgss168.seq 249998390 gbgss169.seq 524288946 gbgss17.seq 249999267 gbgss170.seq 249997904 gbgss171.seq 249996974 gbgss172.seq 76835987 gbgss173.seq 249998100 gbgss174.seq 2079852 gbgss175.seq 79542394 gbgss176.seq 249999009 gbgss177.seq 250000259 gbgss178.seq 87380505 gbgss179.seq 524291200 gbgss18.seq 249999685 gbgss180.seq 249998355 gbgss181.seq 249998984 gbgss182.seq 202719103 gbgss183.seq 249999232 gbgss184.seq 249999013 gbgss185.seq 249998851 gbgss186.seq 246250899 gbgss187.seq 249999268 gbgss188.seq 249997406 gbgss189.seq 314849258 gbgss19.seq 249999279 gbgss190.seq 243520281 gbgss191.seq 249999336 gbgss192.seq 249997150 gbgss193.seq 249998209 gbgss194.seq 249998771 gbgss195.seq 122182588 gbgss196.seq 249998013 gbgss197.seq 250000031 gbgss198.seq 249999974 gbgss199.seq 524289034 gbgss2.seq 524288952 gbgss20.seq 249998152 gbgss200.seq 94058788 gbgss201.seq 249998892 gbgss202.seq 249999850 gbgss203.seq 249998239 gbgss204.seq 249999582 gbgss205.seq 180308144 gbgss206.seq 249999236 gbgss207.seq 249997993 gbgss208.seq 249998006 gbgss209.seq 524289034 gbgss21.seq 249999353 gbgss210.seq 95926739 gbgss211.seq 249999461 gbgss212.seq 249999350 gbgss213.seq 249998406 gbgss214.seq 249998619 gbgss215.seq 249999398 gbgss216.seq 249999995 gbgss217.seq 17245248 gbgss218.seq 249999424 gbgss219.seq 524291398 gbgss22.seq 249999963 gbgss220.seq 249997369 gbgss221.seq 43648880 gbgss222.seq 52862187 gbgss223.seq 249999126 gbgss224.seq 249999236 gbgss225.seq 249997873 gbgss226.seq 249998364 gbgss227.seq 30976250 gbgss228.seq 249997670 gbgss229.seq 524291152 gbgss23.seq 249997588 gbgss230.seq 249999018 gbgss231.seq 250000000 gbgss232.seq 28042636 gbgss233.seq 249997661 gbgss234.seq 249998578 gbgss235.seq 249999047 gbgss236.seq 249997348 gbgss237.seq 249999380 gbgss238.seq 250000153 gbgss239.seq 524291392 gbgss24.seq 178837789 gbgss240.seq 249999812 gbgss241.seq 249998926 gbgss242.seq 249999095 gbgss243.seq 220154622 gbgss244.seq 250000034 gbgss245.seq 249997956 gbgss246.seq 250000074 gbgss247.seq 249998729 gbgss248.seq 195288113 gbgss249.seq 524290581 gbgss25.seq 249999561 gbgss250.seq 249998751 gbgss251.seq 249999600 gbgss252.seq 249999029 gbgss253.seq 249999913 gbgss254.seq 25748608 gbgss255.seq 524290713 gbgss26.seq 524289900 gbgss27.seq 524288854 gbgss28.seq 524289528 gbgss29.seq 524289102 gbgss3.seq 524290730 gbgss30.seq 38753639 gbgss31.seq 524289097 gbgss32.seq 524290723 gbgss33.seq 524288828 gbgss34.seq 524289728 gbgss35.seq 524289696 gbgss36.seq 524289533 gbgss37.seq 524290149 gbgss38.seq 509095937 gbgss39.seq 524290615 gbgss4.seq 524291541 gbgss40.seq 524289016 gbgss41.seq 524291234 gbgss42.seq 28742152 gbgss43.seq 524288946 gbgss44.seq 524291118 gbgss45.seq 524291184 gbgss46.seq 524290985 gbgss47.seq 209346767 gbgss48.seq 524291863 gbgss49.seq 168350020 gbgss5.seq 524291582 gbgss50.seq 524290401 gbgss51.seq 524290464 gbgss52.seq 524290548 gbgss53.seq 524290885 gbgss54.seq 524289963 gbgss55.seq 524289945 gbgss56.seq 524290892 gbgss57.seq 524290809 gbgss58.seq 524290855 gbgss59.seq 524290951 gbgss6.seq 5859198 gbgss60.seq 524289023 gbgss61.seq 524290882 gbgss62.seq 524290246 gbgss63.seq 457238462 gbgss64.seq 524291294 gbgss65.seq 524291022 gbgss66.seq 524290625 gbgss67.seq 524289509 gbgss68.seq 524291296 gbgss69.seq 524289102 gbgss7.seq 524290162 gbgss70.seq 524290176 gbgss71.seq 524290850 gbgss72.seq 524289394 gbgss73.seq 524291500 gbgss74.seq 524290572 gbgss75.seq 524290538 gbgss76.seq 32490242 gbgss77.seq 524289537 gbgss78.seq 524291931 gbgss79.seq 524291704 gbgss8.seq 524289482 gbgss80.seq 524290727 gbgss81.seq 524289703 gbgss82.seq 524289751 gbgss83.seq 524289336 gbgss84.seq 524290248 gbgss85.seq 524289011 gbgss86.seq 524292247 gbgss87.seq 524290044 gbgss88.seq 376569727 gbgss89.seq 524290120 gbgss9.seq 524292172 gbgss90.seq 524291677 gbgss91.seq 524291807 gbgss92.seq 524292003 gbgss93.seq 524289134 gbgss94.seq 524289592 gbgss95.seq 524289866 gbgss96.seq 524291875 gbgss97.seq 524291048 gbgss98.seq 524291620 gbgss99.seq 249992912 gbhtc1.seq 249998418 gbhtc10.seq 249997449 gbhtc11.seq 19305626 gbhtc12.seq 249997534 gbhtc13.seq 249996320 gbhtc14.seq 64316003 gbhtc15.seq 249992681 gbhtc2.seq 249996913 gbhtc3.seq 249991889 gbhtc4.seq 249985674 gbhtc5.seq 249997743 gbhtc6.seq 249996123 gbhtc7.seq 83873876 gbhtc8.seq 249996616 gbhtc9.seq 249904748 gbhtg1.seq 249868447 gbhtg10.seq 249917503 gbhtg100.seq 249844944 gbhtg101.seq 249902534 gbhtg102.seq 249987029 gbhtg103.seq 5671243 gbhtg104.seq 249895732 gbhtg105.seq 249878049 gbhtg106.seq 249900433 gbhtg107.seq 249915790 gbhtg108.seq 249836851 gbhtg109.seq 1107147 gbhtg11.seq 249976359 gbhtg110.seq 249780420 gbhtg111.seq 249873742 gbhtg112.seq 249970078 gbhtg113.seq 167814795 gbhtg114.seq 249997695 gbhtg115.seq 249533556 gbhtg116.seq 249988332 gbhtg117.seq 249895879 gbhtg118.seq 249822759 gbhtg119.seq 249888470 gbhtg12.seq 54512760 gbhtg120.seq 249935891 gbhtg121.seq 249834856 gbhtg122.seq 249931131 gbhtg123.seq 249875691 gbhtg124.seq 249782400 gbhtg125.seq 134760056 gbhtg126.seq 249831507 gbhtg127.seq 249847301 gbhtg128.seq 249819096 gbhtg129.seq 249970424 gbhtg13.seq 249939383 gbhtg130.seq 249998279 gbhtg131.seq 249828527 gbhtg132.seq 249872447 gbhtg133.seq 249867339 gbhtg134.seq 249854169 gbhtg135.seq 76420905 gbhtg136.seq 249587437 gbhtg14.seq 249775919 gbhtg15.seq 249742391 gbhtg16.seq 249169910 gbhtg17.seq 249983662 gbhtg18.seq 249677291 gbhtg19.seq 249994630 gbhtg2.seq 249988730 gbhtg20.seq 237145184 gbhtg21.seq 249760624 gbhtg22.seq 249868408 gbhtg23.seq 249987789 gbhtg24.seq 249921752 gbhtg25.seq 249761207 gbhtg26.seq 249891641 gbhtg27.seq 249961480 gbhtg28.seq 249841969 gbhtg29.seq 249950135 gbhtg3.seq 249992987 gbhtg30.seq 225324756 gbhtg31.seq 249827828 gbhtg32.seq 249920767 gbhtg33.seq 249929437 gbhtg34.seq 249919058 gbhtg35.seq 249858205 gbhtg36.seq 249814604 gbhtg37.seq 249767419 gbhtg38.seq 249627604 gbhtg39.seq 249984089 gbhtg4.seq 249839726 gbhtg40.seq 224363115 gbhtg41.seq 249889211 gbhtg42.seq 249786793 gbhtg43.seq 249972417 gbhtg44.seq 249775813 gbhtg45.seq 249913172 gbhtg46.seq 249598316 gbhtg47.seq 249865084 gbhtg48.seq 249793045 gbhtg49.seq 249882044 gbhtg5.seq 249922715 gbhtg50.seq 235040956 gbhtg51.seq 249732687 gbhtg52.seq 249918496 gbhtg53.seq 249773162 gbhtg54.seq 249971361 gbhtg55.seq 249962512 gbhtg56.seq 18795863 gbhtg57.seq 249861195 gbhtg58.seq 249939539 gbhtg59.seq 249898460 gbhtg6.seq 249990521 gbhtg60.seq 249920304 gbhtg61.seq 225327613 gbhtg62.seq 249854005 gbhtg63.seq 249787648 gbhtg64.seq 249883720 gbhtg65.seq 249980764 gbhtg66.seq 249833261 gbhtg67.seq 16614633 gbhtg68.seq 249960711 gbhtg69.seq 249933725 gbhtg7.seq 249973591 gbhtg70.seq 249953795 gbhtg71.seq 249976832 gbhtg72.seq 225068425 gbhtg73.seq 249811217 gbhtg74.seq 249874983 gbhtg75.seq 249800230 gbhtg76.seq 249959810 gbhtg77.seq 244236211 gbhtg78.seq 249883527 gbhtg79.seq 249933567 gbhtg8.seq 249989775 gbhtg80.seq 249839558 gbhtg81.seq 249838461 gbhtg82.seq 216751380 gbhtg83.seq 249966974 gbhtg84.seq 249803194 gbhtg85.seq 249757813 gbhtg86.seq 249850131 gbhtg87.seq 220831145 gbhtg88.seq 249970053 gbhtg89.seq 249923766 gbhtg9.seq 249954204 gbhtg90.seq 249999447 gbhtg91.seq 249963669 gbhtg92.seq 208918917 gbhtg93.seq 249866049 gbhtg94.seq 249911674 gbhtg95.seq 249904005 gbhtg96.seq 249769960 gbhtg97.seq 167889754 gbhtg98.seq 249744688 gbhtg99.seq 249999729 gbinv1.seq 249999464 gbinv10.seq 249999214 gbinv11.seq 167143988 gbinv12.seq 249995378 gbinv13.seq 249997995 gbinv14.seq 249995483 gbinv15.seq 150828588 gbinv16.seq 249999928 gbinv17.seq 248995288 gbinv18.seq 249998320 gbinv19.seq 249870004 gbinv2.seq 249998808 gbinv20.seq 238112954 gbinv21.seq 220615455 gbinv22.seq 175506919 gbinv23.seq 249997791 gbinv24.seq 249998477 gbinv25.seq 80884318 gbinv26.seq 249999550 gbinv27.seq 249999259 gbinv28.seq 249997711 gbinv29.seq 212085004 gbinv3.seq 184359498 gbinv30.seq 249998496 gbinv4.seq 249999334 gbinv5.seq 249998974 gbinv6.seq 249999025 gbinv7.seq 16559478 gbinv8.seq 249998289 gbinv9.seq 144177333 gbjou1.idx 300941919 gbjou10.idx 261524780 gbjou11.idx 247989182 gbjou12.idx 47871838 gbjou13.idx 140721978 gbjou2.idx 172375994 gbjou3.idx 184093434 gbjou4.idx 269819877 gbjou5.idx 278658578 gbjou6.idx 281568666 gbjou7.idx 280680781 gbjou8.idx 305240627 gbjou9.idx 340242625 gbkey1.idx 180077814 gbkey2.idx 180145860 gbkey3.idx 184381414 gbkey4.idx 301030822 gbkey5.idx 137104095 gbkey6.idx 249863224 gbmam1.seq 249997261 gbmam2.seq 249915148 gbmam3.seq 249999577 gbmam4.seq 250000224 gbmam5.seq 250000032 gbmam6.seq 249996816 gbmam7.seq 3386287 gbmam8.seq 36401723 gbnew.txt 249999772 gbpat1.seq 249999613 gbpat10.seq 249999793 gbpat100.seq 149112469 gbpat101.seq 249999880 gbpat102.seq 249999565 gbpat103.seq 249929731 gbpat104.seq 249824879 gbpat105.seq 249998856 gbpat106.seq 192934428 gbpat107.seq 249999496 gbpat108.seq 249999625 gbpat109.seq 179557952 gbpat11.seq 249996328 gbpat110.seq 80124329 gbpat111.seq 249999327 gbpat112.seq 250000261 gbpat113.seq 249988052 gbpat114.seq 249999878 gbpat115.seq 249849703 gbpat116.seq 66835452 gbpat117.seq 249999441 gbpat118.seq 249999845 gbpat119.seq 250000152 gbpat12.seq 249999888 gbpat120.seq 249999095 gbpat121.seq 160256390 gbpat122.seq 249999974 gbpat123.seq 249999633 gbpat124.seq 234784218 gbpat125.seq 249991591 gbpat126.seq 249970935 gbpat127.seq 249999681 gbpat128.seq 249997397 gbpat129.seq 249995214 gbpat13.seq 249997452 gbpat130.seq 66832984 gbpat131.seq 249992315 gbpat132.seq 249999867 gbpat133.seq 250000197 gbpat134.seq 249999821 gbpat135.seq 249998337 gbpat136.seq 18437114 gbpat137.seq 249999655 gbpat138.seq 249998828 gbpat139.seq 249999071 gbpat14.seq 249999803 gbpat140.seq 220985436 gbpat141.seq 249998039 gbpat142.seq 250000068 gbpat143.seq 250000015 gbpat144.seq 86028783 gbpat145.seq 249999922 gbpat146.seq 249998356 gbpat147.seq 249999124 gbpat148.seq 63537091 gbpat149.seq 249999991 gbpat15.seq 249996936 gbpat150.seq 249999968 gbpat151.seq 249999470 gbpat152.seq 249999961 gbpat153.seq 250000095 gbpat154.seq 249998310 gbpat155.seq 222137448 gbpat156.seq 250000249 gbpat157.seq 249999893 gbpat158.seq 249999893 gbpat159.seq 249999915 gbpat16.seq 220539897 gbpat160.seq 249999753 gbpat161.seq 249998599 gbpat162.seq 249999673 gbpat163.seq 12381933 gbpat164.seq 249997013 gbpat165.seq 249998113 gbpat166.seq 249999975 gbpat167.seq 249999201 gbpat168.seq 35343603 gbpat169.seq 65896429 gbpat17.seq 249998580 gbpat170.seq 249998996 gbpat171.seq 249998092 gbpat172.seq 250000010 gbpat173.seq 249999842 gbpat174.seq 249999544 gbpat175.seq 249993849 gbpat176.seq 249999604 gbpat177.seq 165992988 gbpat178.seq 250000027 gbpat18.seq 249999801 gbpat19.seq 249998573 gbpat2.seq 249999076 gbpat20.seq 249996990 gbpat21.seq 185825051 gbpat22.seq 249998934 gbpat23.seq 249858647 gbpat24.seq 249999397 gbpat25.seq 249999337 gbpat26.seq 71191909 gbpat27.seq 249986100 gbpat28.seq 249998620 gbpat29.seq 249999135 gbpat3.seq 249997666 gbpat30.seq 249999841 gbpat31.seq 250000175 gbpat32.seq 180194091 gbpat33.seq 249997878 gbpat34.seq 249999688 gbpat35.seq 249999436 gbpat36.seq 250000186 gbpat37.seq 130533969 gbpat38.seq 249996407 gbpat39.seq 249997195 gbpat4.seq 249993739 gbpat40.seq 249999063 gbpat41.seq 249999040 gbpat42.seq 249997287 gbpat43.seq 249845172 gbpat44.seq 249999190 gbpat45.seq 250000090 gbpat46.seq 171467978 gbpat47.seq 249999830 gbpat48.seq 249998527 gbpat49.seq 71727149 gbpat5.seq 249999531 gbpat50.seq 250000197 gbpat51.seq 222934467 gbpat52.seq 249999057 gbpat53.seq 249999815 gbpat54.seq 250000246 gbpat55.seq 164989556 gbpat56.seq 249883080 gbpat57.seq 249996731 gbpat58.seq 250000139 gbpat59.seq 249999527 gbpat6.seq 249998980 gbpat60.seq 134927252 gbpat61.seq 249998969 gbpat62.seq 249999978 gbpat63.seq 249999690 gbpat64.seq 249998210 gbpat65.seq 249999753 gbpat66.seq 249999505 gbpat67.seq 144886744 gbpat68.seq 250000113 gbpat69.seq 249998882 gbpat7.seq 249999899 gbpat70.seq 249998837 gbpat71.seq 244403359 gbpat72.seq 248969066 gbpat73.seq 244459261 gbpat74.seq 247875799 gbpat75.seq 249999901 gbpat76.seq 160624439 gbpat77.seq 250000121 gbpat78.seq 249999657 gbpat79.seq 249992125 gbpat8.seq 249999470 gbpat80.seq 249999644 gbpat81.seq 250000008 gbpat82.seq 249998696 gbpat83.seq 93332873 gbpat84.seq 249155886 gbpat85.seq 249999519 gbpat86.seq 249999665 gbpat87.seq 249999359 gbpat88.seq 249999368 gbpat89.seq 249999906 gbpat9.seq 250000155 gbpat90.seq 145293161 gbpat91.seq 249999199 gbpat92.seq 249998980 gbpat93.seq 249999939 gbpat94.seq 250000257 gbpat95.seq 196964910 gbpat96.seq 249999051 gbpat97.seq 249998995 gbpat98.seq 249999064 gbpat99.seq 185841667 gbphg1.seq 249997631 gbpln1.seq 249999556 gbpln10.seq 249994685 gbpln11.seq 249999246 gbpln12.seq 249769731 gbpln13.seq 214812798 gbpln14.seq 249998215 gbpln15.seq 249985349 gbpln16.seq 249996352 gbpln17.seq 249709069 gbpln18.seq 249989832 gbpln19.seq 249938758 gbpln2.seq 249606536 gbpln20.seq 249997642 gbpln21.seq 33449513 gbpln22.seq 249992320 gbpln23.seq 97645141 gbpln24.seq 249998136 gbpln25.seq 249998874 gbpln26.seq 249472852 gbpln27.seq 221100868 gbpln28.seq 241343526 gbpln29.seq 249948110 gbpln3.seq 249951013 gbpln30.seq 246853724 gbpln31.seq 249999150 gbpln32.seq 249999324 gbpln33.seq 245668851 gbpln34.seq 249995400 gbpln35.seq 249998588 gbpln36.seq 249998532 gbpln37.seq 250000234 gbpln38.seq 142563490 gbpln39.seq 249894700 gbpln4.seq 249826526 gbpln40.seq 249853383 gbpln41.seq 249997520 gbpln42.seq 249999982 gbpln43.seq 249999187 gbpln44.seq 189394474 gbpln45.seq 249999237 gbpln46.seq 248399690 gbpln47.seq 249998824 gbpln48.seq 249997630 gbpln49.seq 249867158 gbpln5.seq 249998257 gbpln50.seq 249998650 gbpln51.seq 249912401 gbpln52.seq 249996918 gbpln53.seq 249998794 gbpln54.seq 57105586 gbpln55.seq 249895931 gbpln6.seq 249859070 gbpln7.seq 249998883 gbpln8.seq 33062871 gbpln9.seq 148952874 gbpri1.seq 249783195 gbpri10.seq 129741660 gbpri11.seq 249962747 gbpri12.seq 249896480 gbpri13.seq 249896770 gbpri14.seq 249947119 gbpri15.seq 249902483 gbpri16.seq 249876241 gbpri17.seq 249991978 gbpri18.seq 249903004 gbpri19.seq 249951019 gbpri2.seq 249948092 gbpri20.seq 249949220 gbpri21.seq 249999774 gbpri22.seq 30697664 gbpri23.seq 177481322 gbpri24.seq 249998934 gbpri25.seq 211358086 gbpri26.seq 249987118 gbpri27.seq 249988725 gbpri28.seq 249948820 gbpri29.seq 250000076 gbpri3.seq 249935405 gbpri30.seq 249945956 gbpri31.seq 249974525 gbpri32.seq 249821502 gbpri33.seq 250000227 gbpri34.seq 95881809 gbpri35.seq 249993971 gbpri36.seq 249998020 gbpri37.seq 249997182 gbpri38.seq 249995558 gbpri39.seq 249968482 gbpri4.seq 249998324 gbpri40.seq 181996994 gbpri41.seq 249998670 gbpri42.seq 249998835 gbpri43.seq 249821421 gbpri44.seq 2823579 gbpri45.seq 249956957 gbpri5.seq 249788332 gbpri6.seq 249806906 gbpri7.seq 249867498 gbpri8.seq 249957345 gbpri9.seq 327109 gbrel.txt 249731024 gbrod1.seq 249752589 gbrod10.seq 62793496 gbrod11.seq 249871284 gbrod12.seq 249783783 gbrod13.seq 249992872 gbrod14.seq 249651633 gbrod15.seq 249953778 gbrod16.seq 249885197 gbrod17.seq 249824125 gbrod18.seq 244529626 gbrod19.seq 249935265 gbrod2.seq 249768065 gbrod20.seq 249924095 gbrod21.seq 230194968 gbrod22.seq 249997417 gbrod23.seq 249998350 gbrod24.seq 249980494 gbrod25.seq 249698931 gbrod26.seq 249999786 gbrod27.seq 249997389 gbrod28.seq 205380887 gbrod29.seq 249991951 gbrod3.seq 249987556 gbrod4.seq 249882212 gbrod5.seq 249882945 gbrod6.seq 249748846 gbrod7.seq 249881291 gbrod8.seq 249819838 gbrod9.seq 4175287636 gbsdr1.txt 5811623920 gbsdr2.txt 2713719078 gbsdr3.txt 158159680 gbsec.idx 249999192 gbsts1.seq 249997720 gbsts10.seq 210919464 gbsts11.seq 249996524 gbsts12.seq 249999349 gbsts13.seq 249999266 gbsts14.seq 249999572 gbsts15.seq 24470469 gbsts16.seq 249999107 gbsts17.seq 249997897 gbsts18.seq 249999071 gbsts19.seq 249998220 gbsts2.seq 148702344 gbsts20.seq 249999008 gbsts3.seq 249998277 gbsts4.seq 39162150 gbsts5.seq 249997411 gbsts6.seq 249997774 gbsts7.seq 249997192 gbsts8.seq 249998706 gbsts9.seq 249999701 gbsyn1.seq 249999343 gbsyn2.seq 249947975 gbsyn3.seq 249993942 gbsyn4.seq 249973892 gbsyn5.seq 249963517 gbsyn6.seq 135898060 gbsyn7.seq 249999888 gbtsa1.seq 249996639 gbtsa10.seq 249999168 gbtsa11.seq 127105887 gbtsa12.seq 249997835 gbtsa13.seq 249999221 gbtsa14.seq 249998017 gbtsa15.seq 249997884 gbtsa16.seq 167500778 gbtsa17.seq 249998217 gbtsa18.seq 250000150 gbtsa19.seq 249997963 gbtsa2.seq 249998775 gbtsa20.seq 249998636 gbtsa21.seq 249998457 gbtsa22.seq 249998315 gbtsa23.seq 30034786 gbtsa24.seq 249998710 gbtsa25.seq 249998636 gbtsa26.seq 249991951 gbtsa27.seq 249997904 gbtsa28.seq 250000251 gbtsa29.seq 249998332 gbtsa3.seq 249999084 gbtsa30.seq 204335460 gbtsa31.seq 249998534 gbtsa32.seq 249999961 gbtsa33.seq 249999936 gbtsa34.seq 249997768 gbtsa35.seq 249999157 gbtsa36.seq 249998098 gbtsa37.seq 249998715 gbtsa38.seq 249999115 gbtsa39.seq 250000057 gbtsa4.seq 15553749 gbtsa40.seq 249998020 gbtsa41.seq 249998684 gbtsa42.seq 249999831 gbtsa43.seq 249998532 gbtsa44.seq 249997114 gbtsa45.seq 249998215 gbtsa46.seq 249997456 gbtsa47.seq 155688166 gbtsa48.seq 249997344 gbtsa49.seq 83183501 gbtsa5.seq 249997941 gbtsa50.seq 249996156 gbtsa51.seq 249999083 gbtsa52.seq 249998677 gbtsa53.seq 172935945 gbtsa54.seq 250000247 gbtsa55.seq 249999708 gbtsa56.seq 249999356 gbtsa57.seq 249999756 gbtsa58.seq 250000031 gbtsa59.seq 249999109 gbtsa6.seq 249999361 gbtsa60.seq 22687922 gbtsa61.seq 249997173 gbtsa62.seq 249999729 gbtsa63.seq 250000141 gbtsa64.seq 249998385 gbtsa65.seq 249996693 gbtsa66.seq 249999173 gbtsa67.seq 249999990 gbtsa68.seq 249996036 gbtsa69.seq 249996202 gbtsa7.seq 128381210 gbtsa70.seq 249998532 gbtsa8.seq 249999947 gbtsa9.seq 486108 gbuna1.seq 249998427 gbvrl1.seq 249999520 gbvrl10.seq 165621259 gbvrl11.seq 249993743 gbvrl12.seq 249997548 gbvrl13.seq 249996976 gbvrl14.seq 249991350 gbvrl15.seq 249993971 gbvrl16.seq 249844634 gbvrl17.seq 249999266 gbvrl18.seq 249993875 gbvrl19.seq 249999513 gbvrl2.seq 148266556 gbvrl20.seq 249997872 gbvrl3.seq 249997214 gbvrl4.seq 191368692 gbvrl5.seq 249999338 gbvrl6.seq 249998887 gbvrl7.seq 249998197 gbvrl8.seq 249999975 gbvrl9.seq 249938560 gbvrt1.seq 249762539 gbvrt10.seq 249940020 gbvrt11.seq 185678776 gbvrt12.seq 249995062 gbvrt13.seq 249964366 gbvrt14.seq 249996404 gbvrt15.seq 249998282 gbvrt16.seq 249998297 gbvrt17.seq 250000127 gbvrt18.seq 98577409 gbvrt19.seq 249995736 gbvrt2.seq 249995733 gbvrt20.seq 249997104 gbvrt21.seq 249979155 gbvrt22.seq 249999872 gbvrt23.seq 249999859 gbvrt24.seq 249999045 gbvrt25.seq 83838791 gbvrt26.seq 249934937 gbvrt3.seq 249768425 gbvrt4.seq 100497394 gbvrt5.seq 249996380 gbvrt6.seq 249995207 gbvrt7.seq 249833417 gbvrt8.seq 249951536 gbvrt9.seq 2.2.6 Per-Division Statistics The following table provides a per-division breakdown of the number of sequence entries and the total number of bases of DNA/RNA in each non-CON and non-WGS sequence data file. CON division records, which are constructed from other sequence records, are not represented here because their inclusion would essentially be a form of double-counting. Sequences from Whole Genome Shotgun (WGS) sequencing projects are not represented here because all WGS project data are made available on a per-project basis: ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs ftp://ftp.ncbi.nih.gov/genbank/wgs rather than being incorporated within the GenBank release distribution. Division Entries Bases BCT1 64162 86080328 BCT10 64 115520696 BCT11 93 115223175 BCT12 93 109185533 BCT13 7793 113444113 BCT14 8338 10075530 BCT15 53933 85390803 BCT16 93 110189094 BCT17 151 93915681 BCT18 61 112455059 BCT19 52 112042350 BCT2 4948 109068556 BCT20 46 114233015 BCT21 58 114931588 BCT22 67 111284815 BCT23 36 96325907 BCT24 40 106881287 BCT25 58 105533856 BCT26 74 111675186 BCT27 55 110045255 BCT28 63 106845575 BCT29 55 109391288 BCT3 52 112655257 BCT30 53 108650404 BCT31 46 110496749 BCT32 95 109522868 BCT33 59 110966729 BCT34 67 108616570 BCT35 124 106350090 BCT36 36 69419425 BCT37 202 109105429 BCT38 51 109861512 BCT39 40 106911174 BCT4 55 106656794 BCT40 54 104252121 BCT41 58 107350200 BCT42 44 110960713 BCT43 80 107599606 BCT44 52 108571742 BCT45 46 107138318 BCT46 63 108219635 BCT47 79 107098072 BCT48 62 73603411 BCT49 68 110616305 BCT5 38315 81647768 BCT50 66 105738712 BCT51 49 103628191 BCT52 53 107838942 BCT53 54 107298795 BCT54 66 110212402 BCT55 63 106817738 BCT56 51 108471276 BCT57 60 113686383 BCT58 68 109914717 BCT59 48 109532317 BCT6 39042 82648391 BCT60 61 90279038 BCT61 40 109701549 BCT62 52 113982100 BCT63 83 116758809 BCT64 220 98340538 BCT65 389 55259308 BCT66 1589 2511877 BCT67 3179 5215895 BCT68 6347 7901828 BCT69 12648 15076979 BCT7 5522 96143938 BCT70 25628 27748204 BCT71 50523 53996220 BCT72 76351 77609712 BCT73 71503 77181395 BCT74 9524 94049884 BCT75 5590 104225809 BCT76 3050 104489120 BCT77 65 115712583 BCT78 4225 110939141 BCT79 21695 99799637 BCT8 13867 90150583 BCT80 22504 23359041 BCT81 68103 85895421 BCT82 31596 111221264 BCT83 76398 79491548 BCT84 64653 85585361 BCT85 21105 40373993 BCT9 6748 96304913 ENV1 94213 70705785 ENV10 83201 87256788 ENV11 20310 17512135 ENV12 84823 80873858 ENV13 120494 43465331 ENV14 88806 78124204 ENV15 96617 67733009 ENV16 96143 63502826 ENV17 112423 66792917 ENV18 112950 70114238 ENV19 51886 70059059 ENV2 91585 69030501 ENV20 68113 87692396 ENV21 91170 74656692 ENV22 128361 34412396 ENV23 123053 29095263 ENV24 77642 17797356 ENV25 123134 49867851 ENV26 97603 67837218 ENV27 115950 56102521 ENV28 136476 52688249 ENV29 110004 58709432 ENV3 85163 75461795 ENV30 56068 46860816 ENV31 71058 96548027 ENV32 95504 69634320 ENV33 105832 43038437 ENV34 90015 65250644 ENV35 58832 38488756 ENV36 111420 47249247 ENV37 102063 61145968 ENV38 107479 64238692 ENV39 66718 95281124 ENV4 81850 84109517 ENV40 76838 85407221 ENV41 63898 86835521 ENV42 80136 85233862 ENV43 109372 47853380 ENV44 113829 56804287 ENV45 104169 61243608 ENV46 29564 22854086 ENV47 98105 43605859 ENV48 42795 53982085 ENV49 42416 55310678 ENV5 87667 86739492 ENV50 62894 61534026 ENV51 103562 56109276 ENV52 95970 67690424 ENV53 6211 6259708 ENV6 99659 61449435 ENV7 131779 31253773 ENV8 86336 70531906 ENV9 93292 72987644 EST1 158932 61578479 EST10 167384 72121450 EST100 232216 141229287 EST101 239049 125498755 EST102 191374 104203328 EST103 183073 101721433 EST104 100126 70188276 EST105 160250 119698853 EST106 172068 105366985 EST107 134990 84867353 EST108 64419 24043353 EST109 63773 22429095 EST11 169596 74019620 EST110 64301 23297395 EST111 64313 27058057 EST112 64822 23116602 EST113 65042 24777934 EST114 63924 27190827 EST115 64306 26428083 EST116 64500 27441777 EST117 64330 25261011 EST118 61689 34861993 EST119 142728 68764528 EST12 166774 70072448 EST120 160952 85082333 EST121 177247 92936236 EST122 149335 96411791 EST123 156344 91876388 EST124 120667 78448680 EST125 189547 90842635 EST126 156020 83044793 EST127 157432 84537112 EST128 156646 84683208 EST129 151526 85005646 EST13 72698 34849615 EST130 173194 92948381 EST131 183307 116945010 EST132 202644 102517014 EST133 159215 87090253 EST134 162949 82933097 EST135 142152 83534492 EST136 144874 89606793 EST137 100368 53537057 EST138 173661 98097819 EST139 245088 113014563 EST14 217838 109343769 EST140 154481 83530524 EST141 167281 92280675 EST142 150583 88021841 EST143 133673 81794901 EST144 154305 96690704 EST145 156263 85815443 EST146 124519 63480525 EST147 121486 65239362 EST148 128033 57985231 EST149 127406 51289631 EST15 168614 105338224 EST150 128746 51310533 EST151 114469 42656777 EST152 163868 82710511 EST153 176184 73808792 EST154 162268 110248270 EST155 200071 122703022 EST156 214234 121749827 EST157 175555 97199900 EST158 154925 108273694 EST159 141883 95228538 EST16 178896 112376702 EST160 154957 96144529 EST161 157570 82600116 EST162 139422 78454384 EST163 167646 93244672 EST164 71350 44389422 EST165 149811 91582172 EST166 191842 110270364 EST167 145792 83952102 EST168 142903 72445668 EST169 149074 87099616 EST17 195365 112888403 EST170 190815 104735686 EST171 156517 95970823 EST172 168611 82506591 EST173 125253 86481925 EST174 170276 99777392 EST175 173366 100656755 EST176 122297 68060030 EST177 156951 90277178 EST178 36435 21155183 EST179 169618 102489444 EST18 190600 121507798 EST180 180469 118990336 EST181 143358 116905604 EST182 196491 100136090 EST183 153069 103373147 EST184 154688 101408291 EST185 141172 81675743 EST186 176164 71359078 EST187 150729 84635825 EST188 157698 99727963 EST189 156026 96178675 EST19 159450 114180730 EST190 139836 83260089 EST191 162580 98242763 EST192 145211 92961851 EST193 128726 90041346 EST194 144593 88309627 EST195 135536 88230552 EST196 129452 92543992 EST197 162243 86661813 EST198 173907 95675577 EST199 173405 96487211 EST2 161860 61550624 EST20 186883 99412580 EST200 171644 95246748 EST201 168922 95195497 EST202 171337 95774906 EST203 173197 95031021 EST204 173938 95718287 EST205 27882 15128157 EST206 188685 105126478 EST207 204877 104651788 EST208 172463 102202121 EST209 180099 101691680 EST21 217103 106393398 EST210 200705 122501280 EST211 194157 112118853 EST212 193510 123876517 EST213 157228 103960657 EST214 218812 141916539 EST215 236736 114648394 EST216 145565 103218147 EST217 162226 109301975 EST218 147330 94845693 EST219 177610 98529905 EST22 198877 65990714 EST220 189865 118167864 EST221 111651 87750757 EST222 134717 121226788 EST223 160155 93104966 EST224 148125 95196766 EST225 195149 107691572 EST226 166256 104042756 EST227 134210 92480729 EST228 142126 105317535 EST229 120942 87056348 EST23 141018 40099130 EST230 89638 60475626 EST231 144652 89900997 EST232 132134 93891419 EST233 142317 101310212 EST234 120118 86587828 EST235 125365 84225893 EST236 155510 107959167 EST237 159403 115443099 EST238 119508 122109899 EST239 147901 88896939 EST24 103790 28102413 EST240 184180 119214969 EST241 151711 92267105 EST242 170272 107791482 EST243 168054 121398572 EST244 145113 107989812 EST245 12971 9678788 EST246 155326 99989843 EST247 211413 97479907 EST248 187717 111530409 EST249 152176 86808506 EST25 121275 50794232 EST250 220342 27649171 EST251 221258 90060306 EST252 163443 120935271 EST253 174677 102290813 EST254 161984 107654996 EST255 175937 115401707 EST256 156199 114473783 EST257 99499 53922294 EST258 185660 97472528 EST259 177331 104386043 EST26 213566 97094574 EST260 166017 119646227 EST261 213482 102960447 EST262 271899 118992630 EST263 210078 121329321 EST264 182172 40491392 EST265 244678 112790883 EST266 168758 97452125 EST267 168109 105525988 EST268 91815 57379176 EST269 165531 113935582 EST27 219263 110239962 EST270 198830 103245559 EST271 155624 106032716 EST272 195444 114980818 EST273 197340 49946108 EST274 208517 42424059 EST275 181446 103176132 EST276 169950 114892587 EST277 185717 115670542 EST278 181695 109078782 EST279 156905 101673582 EST28 190467 88601230 EST280 107841 37344621 EST281 143437 86877223 EST282 119164 79296267 EST283 155950 106083791 EST284 247076 37086158 EST285 263884 24185103 EST286 168415 90796834 EST287 167479 109886923 EST288 160595 103952503 EST289 147149 91760601 EST29 158040 68888392 EST290 263043 38157658 EST291 175731 96471944 EST292 66520 50120975 EST293 194329 110878674 EST294 143252 78825666 EST295 183170 119136871 EST296 183197 112461528 EST297 153683 111903121 EST298 192137 107429859 EST299 177874 99893228 EST3 153644 54437600 EST30 171553 69641748 EST300 174773 110155639 EST301 188995 63437396 EST302 187078 69016528 EST303 187611 72818786 EST304 125214 45373251 EST305 191230 89846078 EST306 181275 127352574 EST307 158963 92977616 EST308 155334 90429819 EST309 127297 99048519 EST31 148836 63210737 EST310 148700 98828921 EST311 165608 100460210 EST312 164646 92448828 EST313 171502 102942707 EST314 150258 99210294 EST315 150184 101493034 EST316 164803 107898001 EST317 149771 103689492 EST318 180085 152161556 EST319 173044 113514303 EST32 168367 76122216 EST320 141883 76119370 EST321 143240 97613552 EST322 144927 99502657 EST323 132590 89349450 EST324 149633 99767529 EST325 150477 102011689 EST326 177873 111144016 EST327 151506 83743122 EST328 150733 86371983 EST329 151967 107655438 EST33 173906 66567681 EST330 156361 97008880 EST331 75681 45956729 EST332 142968 90532883 EST333 142929 89593066 EST334 209440 112527130 EST335 130092 71832987 EST336 92275 55615610 EST337 131689 87120460 EST338 137935 87525775 EST339 124440 79213874 EST34 122965 43326123 EST340 167383 85570246 EST341 212777 84744392 EST342 166953 88179181 EST343 175088 104703910 EST344 161773 96782545 EST345 83522 55747465 EST346 133360 88905721 EST347 136677 89442710 EST348 190452 121408611 EST349 157008 96398834 EST35 97391 29892325 EST350 162320 81745164 EST351 185155 130451837 EST352 109805 74759981 EST353 73473 43625440 EST354 142284 79069193 EST355 130779 78156939 EST356 150483 53762921 EST357 158498 32718808 EST358 158573 32533413 EST359 184296 113495154 EST36 97797 30582586 EST360 5944 4240922 EST361 229390 116859858 EST362 250944 114663016 EST363 197334 103799271 EST364 146743 94472859 EST365 136180 87024305 EST366 147045 87147523 EST367 184176 114018990 EST368 226122 77353113 EST369 186892 101073109 EST37 96710 29348028 EST370 218905 121337885 EST371 151563 82314691 EST372 142507 68433019 EST373 199233 122171561 EST374 157519 99832226 EST375 170798 130274295 EST376 182956 145228897 EST377 156546 92572171 EST378 164006 104988610 EST379 187202 110523212 EST38 98629 29837400 EST380 204906 111409963 EST381 194291 108828240 EST382 194308 119343915 EST383 125727 85044258 EST384 198427 131830846 EST385 217600 135159191 EST386 205354 145904795 EST387 212892 163640002 EST388 183880 102530994 EST389 197353 112297908 EST39 99434 31229774 EST390 171286 27391125 EST391 161919 13428167 EST392 156606 22685352 EST393 158379 32997219 EST394 159072 31337631 EST395 55864 11768444 EST396 148102 86461114 EST397 182280 108234299 EST398 163132 112984807 EST399 167467 97716955 EST4 170812 67108330 EST40 23076 5878878 EST400 153312 105825247 EST401 140402 97828221 EST402 144760 95397091 EST403 169649 115356572 EST404 144020 100951684 EST405 174765 103245347 EST406 172427 39945743 EST407 165924 54733358 EST408 145525 101972834 EST409 161718 102245438 EST41 101025 52987591 EST410 166833 108337388 EST411 146842 87896829 EST412 196333 118509890 EST413 148879 102218512 EST414 133043 91209877 EST415 148050 92560237 EST416 157439 94648882 EST417 172254 93463866 EST418 165951 97433605 EST419 160408 95293501 EST42 119533 50861384 EST420 173374 106250071 EST421 140211 88340943 EST422 3222 2352708 EST423 100982 72232372 EST424 79364 60984652 EST425 106713 70193438 EST426 157348 86185580 EST427 126609 77274050 EST428 138419 90773398 EST429 141557 83185898 EST43 165833 91749823 EST430 166222 97085662 EST431 157058 87718862 EST432 195619 116483683 EST433 128248 85149841 EST434 184319 95268657 EST435 182259 89097858 EST436 158984 88820755 EST437 6764 4158502 EST438 169306 98874762 EST439 218749 127919676 EST44 170254 72255064 EST440 162392 110852156 EST441 167018 102578121 EST442 139959 90695380 EST443 136087 92151576 EST444 179446 79397611 EST445 189617 80345705 EST446 205876 86982162 EST447 201312 81493580 EST448 185050 104291938 EST449 124260 72424615 EST45 167198 84830922 EST450 206089 117628498 EST451 182198 112973501 EST452 178651 105126404 EST453 204660 124535646 EST454 137220 96354805 EST455 171931 106093648 EST456 176670 90431009 EST457 152926 86853240 EST458 165186 81815547 EST459 163132 58562700 EST46 168551 86869652 EST460 165424 62323855 EST461 45229 16088356 EST47 163230 87813268 EST48 162128 83269409 EST49 160116 91087098 EST5 168996 66194437 EST50 161625 88116218 EST51 157094 98901838 EST52 159519 69790594 EST53 145842 81630665 EST54 78052 50559365 EST55 167014 69863326 EST56 164649 74766409 EST57 164313 90712748 EST58 159162 97164593 EST59 156445 101474952 EST6 171504 66930687 EST60 164599 98904437 EST61 160080 107988987 EST62 171064 81471700 EST63 173205 92438726 EST64 155564 84205658 EST65 148960 81892229 EST66 158939 98557318 EST67 136005 77105049 EST68 149391 91669478 EST69 194646 107924049 EST7 169836 72796204 EST70 180856 95084462 EST71 221056 121160612 EST72 185403 110480451 EST73 204179 121541284 EST74 163378 90078078 EST75 133985 61439025 EST76 139684 68748140 EST77 154630 93999495 EST78 157915 100353546 EST79 141961 78477477 EST8 179388 72855972 EST80 52901 24643225 EST81 164341 100577778 EST82 212015 114868978 EST83 223666 123667556 EST84 200284 94211847 EST85 211020 93283331 EST86 162181 92865248 EST87 144102 86825952 EST88 164167 81090941 EST89 158119 79855149 EST9 168560 69305073 EST90 152928 102062112 EST91 152072 88946380 EST92 135050 87111324 EST93 156082 113065452 EST94 142345 104168873 EST95 143183 102383840 EST96 141176 97543929 EST97 147010 80970712 EST98 178650 111235772 EST99 225716 136688083 GSS1 200062 87617305 GSS10 132040 60283336 GSS100 145362 114337340 GSS101 141643 116113759 GSS102 143263 116656493 GSS103 167238 128921102 GSS104 149783 82569304 GSS105 191527 120854119 GSS106 167747 112125081 GSS107 197328 115524481 GSS108 204975 134770173 GSS109 209812 138225285 GSS11 137026 73963213 GSS110 207577 140849031 GSS111 206236 142443188 GSS112 205251 143737895 GSS113 205176 143937947 GSS114 202120 146641028 GSS115 182321 139890075 GSS116 18414 10874742 GSS117 132848 84052151 GSS118 169611 80019194 GSS119 184271 79450634 GSS12 147892 75892246 GSS120 170296 148327490 GSS121 177223 120247442 GSS122 184849 149514379 GSS123 192486 124724450 GSS124 187593 137833036 GSS125 192178 126797998 GSS126 190607 95460230 GSS127 166251 152986683 GSS128 164115 115658040 GSS129 66249 42508121 GSS13 145394 68606713 GSS130 171037 155489454 GSS131 172571 154290391 GSS132 172231 155358474 GSS133 173848 154157454 GSS134 172390 153324435 GSS135 184233 143887127 GSS136 182583 147198604 GSS137 163082 115404420 GSS138 206481 88587184 GSS139 265738 40933031 GSS14 169809 84775223 GSS140 265732 40962041 GSS141 57710 8854914 GSS142 256185 58367796 GSS143 253136 60903252 GSS144 193384 82083564 GSS145 194899 73133724 GSS146 185020 152902506 GSS147 179265 156889003 GSS148 172604 159200600 GSS149 193906 127560270 GSS15 161099 97662972 GSS150 245528 58765606 GSS151 210577 101885451 GSS152 92169 20153568 GSS153 87113 63992234 GSS154 83556 62806277 GSS155 103676 48621279 GSS156 68586 58475820 GSS157 7685 7033032 GSS158 68591 57924394 GSS159 69224 56650935 GSS16 172836 87033449 GSS160 69460 56187403 GSS161 71202 55998401 GSS162 68561 51865315 GSS163 75915 58209304 GSS164 87237 74898207 GSS165 81830 44609896 GSS166 92262 44834024 GSS167 63624 47799159 GSS168 77435 61351403 GSS169 69655 58699293 GSS17 183522 113500748 GSS170 67711 62706526 GSS171 61946 53348157 GSS172 95612 42935517 GSS173 21104 4920928 GSS174 112937 70876701 GSS175 823 560132 GSS176 23226 28867035 GSS177 109043 70652585 GSS178 84533 34668223 GSS179 35815 22222733 GSS18 192358 114306485 GSS180 103304 62490220 GSS181 102329 63761256 GSS182 104268 67656826 GSS183 82099 41276456 GSS184 83102 54651503 GSS185 95673 61335435 GSS186 107323 78547443 GSS187 106375 76684757 GSS188 106058 79947480 GSS189 103996 80016519 GSS19 114078 52104778 GSS190 76374 51039123 GSS191 104572 63292187 GSS192 109868 66415305 GSS193 106205 59313311 GSS194 68379 37446344 GSS195 69573 38736929 GSS196 37145 17774305 GSS197 85481 46023427 GSS198 97119 55907586 GSS199 94982 49597190 GSS2 182294 92190593 GSS20 181789 101771260 GSS200 96286 55922591 GSS201 42132 23615490 GSS202 114638 43642267 GSS203 117085 39368203 GSS204 108676 55514545 GSS205 101471 78372335 GSS206 71604 45899517 GSS207 95891 36542252 GSS208 95417 37268709 GSS209 96671 35161518 GSS21 166208 114173594 GSS210 94285 39167432 GSS211 37736 17626556 GSS212 103939 66277823 GSS213 94551 61190929 GSS214 95128 60357048 GSS215 94773 60868501 GSS216 75675 70017159 GSS217 75117 74330280 GSS218 4473 7127270 GSS219 83736 28233267 GSS22 169506 97609042 GSS220 84219 27346468 GSS221 84926 25909272 GSS222 14851 4422302 GSS223 16547 7508221 GSS224 92377 59458826 GSS225 84657 52502700 GSS226 94076 50770605 GSS227 88581 48350254 GSS228 10980 5983348 GSS229 90648 56882510 GSS23 187251 126687349 GSS230 89662 61882079 GSS231 88553 63641206 GSS232 89283 62505584 GSS233 9890 7129098 GSS234 87995 63795538 GSS235 90217 62488977 GSS236 94643 59915214 GSS237 74331 63055090 GSS238 84246 78879440 GSS239 83027 80589521 GSS24 194057 130219707 GSS240 70483 52650376 GSS241 117650 64297121 GSS242 108874 55446727 GSS243 107533 52125503 GSS244 96658 43251344 GSS245 109801 49060015 GSS246 98194 46325477 GSS247 73059 72225597 GSS248 76682 71142435 GSS249 72980 46435649 GSS25 177481 105207105 GSS250 94787 57200301 GSS251 93517 59081345 GSS252 93900 58510429 GSS253 94714 57307691 GSS254 94197 58070562 GSS255 10381 4888399 GSS26 185918 107808246 GSS27 170600 151419573 GSS28 190494 146229226 GSS29 151147 106441309 GSS3 174946 87827370 GSS30 192451 132131298 GSS31 13629 8773195 GSS32 196044 127318947 GSS33 216659 116231837 GSS34 218573 113602417 GSS35 219720 112025390 GSS36 213958 121897898 GSS37 198560 156434224 GSS38 194984 146797396 GSS39 197244 73372753 GSS4 167155 85101061 GSS40 185067 97681159 GSS41 189782 125958599 GSS42 170343 158770231 GSS43 9057 5889153 GSS44 183999 100320381 GSS45 173032 121667203 GSS46 185089 124655109 GSS47 190835 122398633 GSS48 70733 62564650 GSS49 171799 101963548 GSS5 53445 31617730 GSS50 167647 103037030 GSS51 167798 102616122 GSS52 184194 121477291 GSS53 184774 116632196 GSS54 181686 122485290 GSS55 187531 113994336 GSS56 189392 134519036 GSS57 178947 104938173 GSS58 195714 120562148 GSS59 179925 133347010 GSS6 161617 84471320 GSS60 1899 1719195 GSS61 172844 138948397 GSS62 161635 111553347 GSS63 161673 111572480 GSS64 158827 107592995 GSS65 156768 129062324 GSS66 170185 142553826 GSS67 179844 117096102 GSS68 204911 127968663 GSS69 193332 110756601 GSS7 165322 79361222 GSS70 243921 125965583 GSS71 160206 106329772 GSS72 159349 119781671 GSS73 162663 124539163 GSS74 162629 124600831 GSS75 175106 108958250 GSS76 190310 140120691 GSS77 13118 7645896 GSS78 199135 126616367 GSS79 170370 111603100 GSS8 165782 88979718 GSS80 200718 131518447 GSS81 211575 85835271 GSS82 187842 98659368 GSS83 131802 92017231 GSS84 146986 118083551 GSS85 139587 116995322 GSS86 142817 114062378 GSS87 144008 119847686 GSS88 141842 115691442 GSS89 106718 88926972 GSS9 137999 67157765 GSS90 149425 122240891 GSS91 147663 117692857 GSS92 143995 113064403 GSS93 142869 115422868 GSS94 144203 119656289 GSS95 148069 121684067 GSS96 147696 117745472 GSS97 146077 121054040 GSS98 146145 120923099 GSS99 146569 120073651 HTC1 25057 27045808 HTC10 54086 70649526 HTC11 81570 70440536 HTC12 4578 5328118 HTC13 66993 60073171 HTC14 68556 69499762 HTC15 23915 16110324 HTC2 16086 36243320 HTC3 16029 36627693 HTC4 16251 35560357 HTC5 15980 40344457 HTC6 16068 37474845 HTC7 53834 31477922 HTC8 31137 19451907 HTC9 60867 78012683 HTG1 1318 188771164 HTG10 1298 186340737 HTG100 990 189440077 HTG101 996 189331054 HTG102 985 189419172 HTG103 1161 190585510 HTG104 30 4314892 HTG105 1087 189830459 HTG106 1045 189717260 HTG107 1388 191466263 HTG108 1297 190889828 HTG109 1631 191092465 HTG11 6 837687 HTG110 1345 192062486 HTG111 1298 191976235 HTG112 1307 190136719 HTG113 1057 186193849 HTG114 787 126039234 HTG115 1507 182670439 HTG116 1000 191646810 HTG117 928 180615941 HTG118 1077 193771910 HTG119 1103 193021003 HTG12 1452 184004673 HTG120 225 42236728 HTG121 1029 189520679 HTG122 1054 192676832 HTG123 1164 192084660 HTG124 1083 192945775 HTG125 1083 192937725 HTG126 590 104030016 HTG127 1122 192568597 HTG128 1080 192404608 HTG129 1078 192329473 HTG13 875 191786413 HTG130 1167 192001881 HTG131 1561 191903933 HTG132 1069 192200929 HTG133 1070 192324820 HTG134 1129 191775935 HTG135 1434 188074063 HTG136 410 54193644 HTG14 753 191921309 HTG15 745 191963148 HTG16 785 191933231 HTG17 796 191351096 HTG18 775 192103394 HTG19 2069 170638342 HTG2 2470 186037380 HTG20 1096 187413748 HTG21 887 180042173 HTG22 785 191651644 HTG23 928 190141652 HTG24 907 190491600 HTG25 811 191323929 HTG26 784 191771279 HTG27 874 191079273 HTG28 896 190515178 HTG29 939 189959636 HTG3 2513 185208586 HTG30 911 190941779 HTG31 841 171449145 HTG32 875 191097680 HTG33 968 189501635 HTG34 884 191025385 HTG35 868 191276405 HTG36 825 191702609 HTG37 949 189868158 HTG38 949 190351720 HTG39 940 190045229 HTG4 2550 188439001 HTG40 1049 189067591 HTG41 1089 167537350 HTG42 1256 188119418 HTG43 1169 188010117 HTG44 1150 188080035 HTG45 1117 191232412 HTG46 1269 190634433 HTG47 1176 190820695 HTG48 1128 191224702 HTG49 1046 191244150 HTG5 1283 185453274 HTG50 1030 189619303 HTG51 1042 178756613 HTG52 968 190052338 HTG53 1105 190148899 HTG54 1046 190158403 HTG55 1014 189831932 HTG56 969 189170679 HTG57 81 14306584 HTG58 1010 189338312 HTG59 1031 189990377 HTG6 1273 185124562 HTG60 1078 187304761 HTG61 1125 188306505 HTG62 988 170992054 HTG63 1085 189487801 HTG64 1064 189415560 HTG65 1169 188798107 HTG66 1179 187545797 HTG67 1282 184397923 HTG68 94 12194080 HTG69 1221 185314622 HTG7 1276 185375030 HTG70 1239 184674446 HTG71 1244 184625496 HTG72 1183 187688486 HTG73 1019 170126516 HTG74 1118 188293510 HTG75 1103 190775743 HTG76 1135 190789237 HTG77 1182 190871034 HTG78 1096 185997580 HTG79 1171 190202119 HTG8 1459 184608562 HTG80 1115 190063261 HTG81 1213 189874691 HTG82 1120 189645029 HTG83 959 164682536 HTG84 1229 188409093 HTG85 1250 187741728 HTG86 1141 189879061 HTG87 1144 189686641 HTG88 978 167870813 HTG89 1182 189961005 HTG9 1200 186916809 HTG90 1104 190233697 HTG91 1146 190217975 HTG92 1109 190471215 HTG93 962 159420591 HTG94 1056 190751235 HTG95 1160 190986098 HTG96 1031 189156227 HTG97 1071 189497493 HTG98 684 127508859 HTG99 1018 189641315 INV1 94030 48425184 INV10 58410 86358231 INV11 83450 65367671 INV12 55761 44093490 INV13 84914 66260819 INV14 80842 66937694 INV15 78403 68066612 INV16 45955 42207642 INV17 33789 109968824 INV18 2848 147829211 INV19 47139 107525912 INV2 20175 157140059 INV20 77367 55604224 INV21 69166 59605112 INV22 20263 125328512 INV23 6 133712559 INV24 53996 99286268 INV25 79019 53690720 INV26 24490 18580231 INV27 79338 56093644 INV28 78405 61339525 INV29 71848 45444078 INV3 1591 157167189 INV30 30770 73804443 INV4 3882 133970248 INV5 78846 73618689 INV6 55455 96067466 INV7 53617 88152477 INV8 5327 4862617 INV9 80576 71773092 MAM1 15788 161831171 MAM2 20030 157499285 MAM3 58763 82886123 MAM4 8181 184063878 MAM5 79439 74704525 MAM6 52115 121062132 MAM7 72484 64821841 MAM8 982 1010908 PAT1 222552 70120341 PAT10 124455 102575240 PAT100 178185 3385515 PAT101 132610 2848492 PAT102 342935 8573375 PAT103 188806 88519660 PAT104 111348 132068608 PAT105 3850 194703659 PAT106 131292 110979300 PAT107 158599 54826034 PAT108 224730 34113420 PAT109 250080 15844360 PAT11 98617 64109656 PAT110 180680 63677151 PAT111 51648 26046194 PAT112 114183 110462028 PAT113 137705 83279098 PAT114 164161 99347886 PAT115 158877 103325984 PAT116 137417 114988187 PAT117 42311 27994848 PAT118 193712 81686401 PAT119 150217 108404022 PAT12 142065 62828791 PAT120 356051 11379688 PAT121 257211 57607099 PAT122 138161 48226925 PAT123 322021 22795469 PAT124 155639 102753887 PAT125 132727 110696284 PAT126 128341 121313309 PAT127 21664 184390005 PAT128 144888 112900567 PAT129 171997 96403773 PAT13 105888 59875034 PAT130 44618 171217879 PAT131 9167 47581637 PAT132 33645 178334734 PAT133 153558 109675196 PAT134 178705 90913377 PAT135 136049 115324159 PAT136 120392 123342367 PAT137 8527 8992390 PAT138 155429 101473147 PAT139 184764 88815933 PAT14 103642 50160321 PAT140 182409 85292093 PAT141 158459 76051815 PAT142 203662 47737230 PAT143 277828 9627968 PAT144 220409 46465135 PAT145 106719 2881142 PAT146 270386 21672571 PAT147 186751 61239638 PAT148 109801 106056999 PAT149 47516 9550419 PAT15 121148 53317075 PAT150 87299 88249520 PAT151 78465 95588128 PAT152 145199 77694828 PAT153 167500 71382695 PAT154 121465 92942668 PAT155 102978 85383928 PAT156 165566 46016231 PAT157 270022 5130418 PAT158 269978 5129582 PAT159 269978 5129582 PAT16 113137 61274458 PAT160 237888 4519872 PAT161 269396 5118524 PAT162 235480 25575098 PAT163 203734 47154417 PAT164 12033 422577 PAT165 165317 74871979 PAT166 91686 126656173 PAT167 172589 71662882 PAT168 137861 72260460 PAT169 9532 13982682 PAT17 39159 16235508 PAT170 93111 87244841 PAT171 91681 79829797 PAT172 83213 91467896 PAT173 109151 53717404 PAT174 137256 66884705 PAT175 91439 135332665 PAT176 160046 76731776 PAT177 219126 42906029 PAT178 107286 49462344 PAT18 146771 52594264 PAT19 153705 78039102 PAT2 194525 84650653 PAT20 104995 118172564 PAT21 133550 95503155 PAT22 84598 79322013 PAT23 123563 103405415 PAT24 119415 105656371 PAT25 145486 86670068 PAT26 175165 64299073 PAT27 71371 1784275 PAT28 102171 77387698 PAT29 93955 87644560 PAT3 171981 95897120 PAT30 119942 61673191 PAT31 96645 78968068 PAT32 128387 55025904 PAT33 92210 51123413 PAT34 111297 78150994 PAT35 138100 29119820 PAT36 158503 24081830 PAT37 114681 49019496 PAT38 44867 54579973 PAT39 95732 83191686 PAT4 153748 106056406 PAT40 100232 70984798 PAT41 136206 39303264 PAT42 143774 35446826 PAT43 123731 64736974 PAT44 104361 81207665 PAT45 93445 74211542 PAT46 113255 66591457 PAT47 65218 54831902 PAT48 135193 108001084 PAT49 167081 97032398 PAT5 57146 23927792 PAT50 116397 127555645 PAT51 196343 76722711 PAT52 80302 127991032 PAT53 27631 180872621 PAT54 185408 93066629 PAT55 274259 6856475 PAT56 129447 31627433 PAT57 161320 77719729 PAT58 92811 89402778 PAT59 106516 74782837 PAT6 170642 91909261 PAT60 122361 64031080 PAT61 67427 30298000 PAT62 70750 109767817 PAT63 87947 82758966 PAT64 92971 78937516 PAT65 93166 72441718 PAT66 93384 75085880 PAT67 115775 60531183 PAT68 102736 9941783 PAT69 175933 10547809 PAT7 154777 88234848 PAT70 171510 10872561 PAT71 171496 10866737 PAT72 99859 86225043 PAT73 99 196466297 PAT74 67 192869889 PAT75 103 195600591 PAT76 1137 196318757 PAT77 97599 5772236 PAT78 151009 9636510 PAT79 151022 9621259 PAT8 131210 96916575 PAT80 151024 9622125 PAT81 151021 9620837 PAT82 94633 88060720 PAT83 93689 93464843 PAT84 34072 33980702 PAT85 83459 93185861 PAT86 15570 180450165 PAT87 164898 19209900 PAT88 178944 3399936 PAT89 177434 3371246 PAT9 129384 101126296 PAT90 175305 3330795 PAT91 101391 1926429 PAT92 169171 12412246 PAT93 178699 3395281 PAT94 178691 3395129 PAT95 178677 3394863 PAT96 140780 2674820 PAT97 178683 3394977 PAT98 178342 3388498 PAT99 178198 3385762 PHG1 6491 76133941 PLN1 59913 93484134 PLN10 73070 75870744 PLN11 37424 49319698 PLN12 40274 65682533 PLN13 22520 123858969 PLN14 21104 99666209 PLN15 17578 144865462 PLN16 17634 146278605 PLN17 17564 146392665 PLN18 24636 128667828 PLN19 6000 149205408 PLN2 43093 112069053 PLN20 1266 170315035 PLN21 14133 155912002 PLN22 7127 8366760 PLN23 67254 69760900 PLN24 29374 31573527 PLN25 76952 76375515 PLN26 65428 81393596 PLN27 44752 113983780 PLN28 42 85481108 PLN29 12 89108600 PLN3 1365 175807729 PLN30 1105 146780237 PLN31 26200 129369586 PLN32 53176 99017179 PLN33 74531 77751661 PLN34 96678 54025462 PLN35 80386 71664752 PLN36 77898 75915989 PLN37 80012 70526751 PLN38 82166 75440715 PLN39 57726 31573435 PLN4 1806 185612416 PLN40 98608 55062825 PLN41 81868 69076883 PLN42 46045 98458875 PLN43 26654 123344127 PLN44 24992 131748389 PLN45 59373 56637024 PLN46 81582 72158051 PLN47 62521 82550375 PLN48 46248 95940195 PLN49 84620 62791229 PLN5 1873 193897887 PLN50 93467 60393156 PLN51 76116 76755699 PLN52 67885 81583272 PLN53 75729 72787010 PLN54 65638 82828990 PLN55 10004 21876904 PLN6 1694 194475169 PLN7 14096 158201938 PLN8 75669 79697544 PLN9 9723 10086297 PRI1 23017 59647552 PRI10 1272 179275558 PRI11 775 94029396 PRI12 1278 179183454 PRI13 1451 177770436 PRI14 1589 180081042 PRI15 1591 181937113 PRI16 1285 191720215 PRI17 1137 193666240 PRI18 1099 194310776 PRI19 1166 193657185 PRI2 18386 149285375 PRI20 1737 191818169 PRI21 2646 189791628 PRI22 16648 165526679 PRI23 4197 16004489 PRI24 31573 84616058 PRI25 61951 78207697 PRI26 31350 70628098 PRI27 8521 161801360 PRI28 2251 180645625 PRI29 1618 181509288 PRI3 1433 175278790 PRI30 2007 181705860 PRI31 1958 180727178 PRI32 13185 156524900 PRI33 1327 183635528 PRI34 41712 106643745 PRI35 22922 33120663 PRI36 32189 63608729 PRI37 20141 117697460 PRI38 18567 147180178 PRI39 66637 86857087 PRI4 1282 185555745 PRI40 49476 89674633 PRI41 40090 73818007 PRI42 45895 95119257 PRI43 21236 107095517 PRI44 60645 97495867 PRI45 95 1849462 PRI5 1325 184390308 PRI6 1180 179907324 PRI7 1246 180917243 PRI8 1212 178442526 PRI9 1367 174647124 ROD1 32911 139685926 ROD10 988 181377551 ROD11 239 45370799 ROD12 1034 185475616 ROD13 940 182703335 ROD14 1040 189324025 ROD15 950 180306408 ROD16 967 182057152 ROD17 991 185811349 ROD18 1189 190476978 ROD19 16761 153123318 ROD2 916 175508672 ROD20 20349 148361192 ROD21 1132 182075942 ROD22 1079 168189648 ROD23 13589 162647066 ROD24 38849 69272202 ROD25 21814 104561488 ROD26 1508 187599166 ROD27 134648 36929290 ROD28 84665 70585729 ROD29 56078 61772543 ROD3 906 173439055 ROD4 901 173910839 ROD5 921 174293473 ROD6 966 178089033 ROD7 969 179528121 ROD8 978 181261578 ROD9 993 181732614 STS1 85283 36763581 STS10 57907 44420267 STS11 48910 37503235 STS12 57924 43637361 STS13 64284 42850769 STS14 93606 34184225 STS15 104286 26517062 STS16 10116 2741066 STS17 103611 27476228 STS18 86929 34448302 STS19 99733 33367597 STS2 84354 49850025 STS20 54946 21015272 STS3 66846 26362760 STS4 76989 36945836 STS5 8457 4958885 STS6 54259 31650966 STS7 54162 31838227 STS8 54316 31957697 STS9 55716 37767321 SYN1 42774 77230624 SYN2 49398 68092607 SYN3 11297 159509957 SYN4 4599 176558803 SYN5 4596 176481519 SYN6 4600 176574698 SYN7 5730 91406667 TSA1 120472 38235688 TSA10 108480 37671630 TSA11 82649 29706806 TSA12 63000 19185998 TSA13 86486 70566494 TSA14 121991 38853496 TSA15 134870 35826510 TSA16 61036 79698424 TSA17 39468 53516874 TSA18 70282 97466599 TSA19 100897 57123531 TSA2 113532 41666458 TSA20 110668 52338593 TSA21 102984 53513191 TSA22 103695 52518403 TSA23 100966 47107597 TSA24 10786 6455891 TSA25 66573 59369298 TSA26 93236 68475106 TSA27 91230 65647744 TSA28 81583 80063334 TSA29 106309 44169463 TSA3 110396 41019325 TSA30 111906 40187704 TSA31 74352 59868448 TSA32 94911 35699810 TSA33 83189 31995816 TSA34 110188 45124503 TSA35 114753 50951737 TSA36 103616 51971055 TSA37 100207 56361687 TSA38 94449 65161201 TSA39 94183 70028525 TSA4 110949 45737681 TSA40 7555 2060048 TSA41 90902 71737996 TSA42 97659 54669853 TSA43 63227 108203943 TSA44 89918 77978879 TSA45 87807 65963439 TSA46 86501 67914552 TSA47 77483 79677214 TSA48 40419 62590589 TSA49 90931 66884444 TSA5 43179 10927440 TSA50 76043 84732155 TSA51 71912 78529712 TSA52 87476 82320347 TSA53 85577 88524564 TSA54 52282 74036179 TSA55 83432 74232816 TSA56 92894 50247879 TSA57 99796 54211962 TSA58 75921 66574803 TSA59 100099 60680015 TSA6 112457 59449948 TSA60 101952 51211507 TSA61 10383 4882421 TSA62 99281 63957845 TSA63 88688 72428374 TSA64 94761 54801841 TSA65 64452 76231537 TSA66 63187 106522299 TSA67 97306 76738816 TSA68 119366 49283699 TSA69 64143 75536862 TSA7 95611 66253193 TSA70 26123 41424160 TSA8 105744 68773673 TSA9 105928 64845351 UNA1 239 125812 VRL1 68000 69111339 VRL10 63739 70922566 VRL11 35161 49335789 VRL12 62840 71114135 VRL13 57409 72810185 VRL14 63333 65144477 VRL15 56981 73339527 VRL16 58036 71828142 VRL17 57087 71440499 VRL18 56541 72565031 VRL19 54703 74372382 VRL2 73436 64286574 VRL20 42809 41838740 VRL3 69820 60872960 VRL4 68448 69802524 VRL5 49830 52120412 VRL6 48193 77586401 VRL7 47199 72783245 VRL8 59487 73393468 VRL9 69158 66834206 VRT1 41751 123661295 VRT10 1256 189144082 VRT11 8274 177844568 VRT12 3994 136790703 VRT13 13095 170781188 VRT14 5348 182619924 VRT15 3936 186026494 VRT16 37596 134587584 VRT17 79811 68470121 VRT18 78293 66432750 VRT19 30908 24954989 VRT2 1924 193292342 VRT20 71345 77340392 VRT21 47242 120548901 VRT22 77529 63451720 VRT23 79408 61820374 VRT24 82261 56136815 VRT25 103632 65082902 VRT26 24107 23908914 VRT3 71806 78786905 VRT4 8447 170157397 VRT5 31318 27682745 VRT6 73011 66719150 VRT7 31732 63525748 VRT8 30652 111958169 VRT9 1202 189984871 2.2.7 Selected Per-Organism Statistics The following table provides the number of entries and bases of DNA/RNA for the twenty most sequenced organisms in Release 189.0, excluding chloroplast and mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences, 'constructed' CON-division sequences, and uncultured sequences: Entries Bases Species 19592636 16097851246 Homo sapiens 9696453 9972466215 Mus musculus 2187786 6514195133 Rattus norvegicus 2200303 5384282799 Bos taurus 3932778 5060128699 Zea mays 3285539 4884132947 Sus scrofa 1712969 3123157778 Danio rerio 257393 1435010041 Strongylocentrotus purpuratus 1348170 1254391972 Oryza sativa Japonica Group 1774072 1197076779 Nicotiana tabacum 1424382 1147263423 Xenopus (Silurana) tropicalis 2329477 1143557236 Arabidopsis thaliana 1229441 1084849933 Drosophila melanogaster 216600 1008269679 Pan troglodytes 766620 998781168 Vitis vinifera 1455547 950994954 Canis lupus familiaris 142432 926878984 Macaca mulatta 1902736 906521373 Glycine max 814914 899255531 Gallus gallus 1426357 896790717 Triticum aestivum 2.2.8 Growth of GenBank The following table lists the number of bases and the number of sequence records in each release of GenBank, beginning with Release 3 in 1982. CON-division records are not represented in these statistics: because they are constructed from the non-CON records in the database, their inclusion here would be a form of double-counting. From 1982 to the present, the number of bases in GenBank has doubled approximately every 18 months. Release Date Base Pairs Entries 3 Dec 1982 680338 606 14 Nov 1983 2274029 2427 20 May 1984 3002088 3665 24 Sep 1984 3323270 4135 25 Oct 1984 3368765 4175 26 Nov 1984 3689752 4393 32 May 1985 4211931 4954 36 Sep 1985 5204420 5700 40 Feb 1986 5925429 6642 42 May 1986 6765476 7416 44 Aug 1986 8442357 8823 46 Nov 1986 9615371 9978 48 Feb 1987 10961380 10913 50 May 1987 13048473 12534 52 Aug 1987 14855145 14020 53 Sep 1987 15514776 14584 54 Dec 1987 16752872 15465 55 Mar 1988 19156002 17047 56 Jun 1988 20795279 18226 57 Sep 1988 22019698 19044 57.1 Oct 1988 23800000 20579 58 Dec 1988 24690876 21248 59 Mar 1989 26382491 22479 60 Jun 1989 31808784 26317 61 Sep 1989 34762585 28791 62 Dec 1989 37183950 31229 63 Mar 1990 40127752 33377 64 Jun 1990 42495893 35100 65 Sep 1990 49179285 39533 66 Dec 1990 51306092 41057 67 Mar 1991 55169276 43903 68 Jun 1991 65868799 51418 69 Sep 1991 71947426 55627 70 Dec 1991 77337678 58952 71 Mar 1992 83894652 65100 72 Jun 1992 92160761 71280 73 Sep 1992 101008486 78608 74 Dec 1992 120242234 97084 75 Feb 1993 126212259 106684 76 Apr 1993 129968355 111911 77 Jun 1993 138904393 120134 78 Aug 1993 147215633 131328 79 Oct 1993 157152442 143492 80 Dec 1993 163802597 150744 81 Feb 1994 173261500 162946 82 Apr 1994 180589455 169896 83 Jun 1994 191393939 182753 84 Aug 1994 201815802 196703 85 Oct 1994 217102462 215273 86 Dec 1994 230485928 237775 87 Feb 1995 248499214 269478 88 Apr 1995 286094556 352414 89 Jun 1995 318624568 425211 90 Aug 1995 353713490 492483 91 Oct 1995 384939485 555694 92 Dec 1995 425860958 620765 93 Feb 1996 463758833 685693 94 Apr 1996 499127741 744295 95 Jun 1996 551750920 835487 96 Aug 1996 602072354 920588 97 Oct 1996 651972984 1021211 98 Dec 1996 730552938 1114581 99 Feb 1997 786898138 1192505 100 Apr 1997 842864309 1274747 101 Jun 1997 966993087 1491069 102 Aug 1997 1053474516 1610848 103 Oct 1997 1160300687 1765847 104 Dec 1997 1258290513 1891953 105 Feb 1998 1372368913 2042325 106 Apr 1998 1502542306 2209232 107 Jun 1998 1622041465 2355928 108 Aug 1998 1797137713 2532359 109 Oct 1998 2008761784 2837897 110 Dec 1998 2162067871 3043729 111 Apr 1999 2569578208 3525418 112 Jun 1999 2974791993 4028171 113 Aug 1999 3400237391 4610118 114 Oct 1999 3841163011 4864570 115 Dec 1999 4653932745 5354511 116 Feb 2000 5805414935 5691170 117 Apr 2000 7376080723 6215002 118 Jun 2000 8604221980 7077491 119 Aug 2000 9545724824 8214339 120 Oct 2000 10335692655 9102634 121 Dec 2000 11101066288 10106023 122 Feb 2001 11720120326 10896781 123 Apr 2001 12418544023 11545572 124 Jun 2001 12973707065 12243766 125 Aug 2001 13543364296 12813516 126 Oct 2001 14396883064 13602262 127 Dec 2001 15849921438 14976310 128 Feb 2002 17089143893 15465325 129 Apr 2002 19072679701 16769983 130 Jun 2002 20648748345 17471130 131 Aug 2002 22616937182 18197119 132 Oct 2002 26525934656 19808101 133 Dec 2002 28507990166 22318883 134 Feb 2003 29358082791 23035823 135 Apr 2003 31099264455 24027936 136 Jun 2003 32528249295 25592865 137 Aug 2003 33865022251 27213748 138 Oct 2003 35599621471 29819397 139 Dec 2003 36553368485 30968418 140 Feb 2004 37893844733 32549400 141 Apr 2004 38989342565 33676218 142 Jun 2004 40325321348 35532003 143 Aug 2004 41808045653 37343937 144 Oct 2004 43194602655 38941263 145 Dec 2004 44575745176 40604319 146 Feb 2005 46849831226 42734478 147 Apr 2005 48235738567 44202133 148 Jun 2005 49398852122 45236251 149 Aug 2005 51674486881 46947388 150 Oct 2005 53655236500 49152445 151 Dec 2005 56037734462 52016762 152 Feb 2006 59750386305 54584635 153 Apr 2006 61582143971 56620500 154 Jun 2006 63412609711 58890345 155 Aug 2006 65369091950 61132599 156 Oct 2006 66925938907 62765195 157 Dec 2006 69019290705 64893747 158 Feb 2007 71292211453 67218344 159 Apr 2007 75742041056 71802595 160 Jun 2007 77248690945 73078143 161 Aug 2007 79525559650 76146236 162 Oct 2007 81563399765 77632813 163 Dec 2007 83874179730 80388382 164 Feb 2008 85759586764 82853685 165 Apr 2008 89172350468 85500730 166 Jun 2008 92008611867 88554578 167 Aug 2008 95033791652 92748599 168 Oct 2008 97381682336 96400790 169 Dec 2008 99116431942 98868465 170 Feb 2009 101467270308 101815678 171 Apr 2009 102980268709 103335421 172 Jun 2009 105277306080 106073709 173 Aug 2009 106533156756 108431692 174 Oct 2009 108560236506 110946879 175 Dec 2009 110118557163 112910950 176 Feb 2010 112326229652 116461672 177 Apr 2010 114348888771 119112251 178 Jun 2010 115624497715 120604423 179 Aug 2010 117476523128 122941883 180 Oct 2010 118551641086 125764384 181 Dec 2010 122082812719 129902276 182 Feb 2011 124277818310 132015054 183 Apr 2011 126551501141 135440924 184 Jun 2011 129178292958 140482268 185 Aug 2011 130671233801 142284608 186 Oct 2011 132067413372 144458648 187 Dec 2011 135117731375 146413798 188 Feb 2012 137384889783 149819246 189 Apr 2012 139266481398 151824421 The following table lists the number of bases and the number of sequence records for WGS sequences processed at GenBank, beginning with Release 129.0 in April of 2002. Please note that WGS data are not distributed in conjunction with GenBank releases. Rather, per-project data files are continuously available in the WGS areas of the NCBI FTP site: ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs ftp://ftp.ncbi.nih.gov/genbank/wgs Release Date Base Pairs Entries 129 Apr 2002 692266338 172768 130 Jun 2002 3267608441 397502 131 Aug 2002 3848375582 427771 132 Oct 2002 3892435593 434224 133 Dec 2002 6702372564 597042 134 Feb 2003 6705740844 597345 135 Apr 2003 6897080355 596818 136 Jun 2003 6992663962 607155 137 Aug 2003 7144761762 593801 138 Oct 2003 8662242833 1683437 139 Dec 2003 14523454868 2547094 140 Feb 2004 22804145885 3188754 141 Apr 2004 24758556215 4112532 142 Jun 2004 25592758366 4353890 143 Aug 2004 28128611847 4427773 144 Oct 2004 30871590379 5285276 145 Dec 2004 35009256228 5410415 146 Feb 2005 38076300084 6111782 147 Apr 2005 39523208346 6685746 148 Jun 2005 46767232565 8711924 149 Aug 2005 53346605784 10276161 150 Oct 2005 56162807647 11169448 151 Dec 2005 59638900034 12088491 152 Feb 2006 63183065091 12465546 153 Apr 2006 67488612571 13573144 154 Jun 2006 78858635822 17733973 155 Aug 2006 80369977826 17960667 156 Oct 2006 81127502509 18500772 157 Dec 2006 81611376856 18540918 158 Feb 2007 86043478524 19421576 159 Apr 2007 93022691867 23446831 160 Jun 2007 97102606459 23718400 161 Aug 2007 101964323738 25384475 162 Oct 2007 102003045298 25354041 163 Dec 2007 106505691578 26177471 164 Feb 2008 108635736141 27439206 165 Apr 2008 110500961400 26931049 166 Jun 2008 113639291344 39163548 167 Aug 2008 118593509342 40214247 168 Oct 2008 136085973423 46108952 169 Dec 2008 141374971004 48394838 170 Feb 2009 143797800446 49036947 171 Apr 2009 144522542010 48948309 172 Jun 2009 145959997864 49063546 173 Aug 2009 148165117763 48443067 174 Oct 2009 149348923035 48119301 175 Dec 2009 158317168385 54076973 176 Feb 2010 163991858015 57134273 177 Apr 2010 165536009514 58361599 178 Jun 2010 167725292032 58592700 179 Aug 2010 169253846128 58994334 180 Oct 2010 175339059129 59397637 181 Dec 2010 177385297156 59608311 182 Feb 2011 190034462797 62349795 183 Apr 2011 191401393188 62715288 184 Jun 2011 200487078184 63735078 185 Aug 2011 208315831132 64997137 186 Oct 2011 218666368056 68330215 187 Dec 2011 239868309609 73729553 188 Feb 2012 261370512675 78656704 189 Apr 2012 272693351548 80905298 3. FILE FORMATS The flat file examples included in this section, while not always from the current release, are usually fairly recent. Any differences compared to the actual records are the result of updates to the entries involved. 3.1 File Header Information With the exception of the index files and the lists of new, changed, and deleted accession numbers, each of the files of a GenBank release begins with the same header, except for the first line, which contains the file name, and the sixth line, which contains the title of the file. The first line of the file contains the file name in character positions 1 to 9 and the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting in column 22. The brief names of the files in this release are listed in Section 2.2. The second line contains the date of the current release in the form `day month year', beginning in position 27. The fourth line contains the current GenBank release number. The release number appears in positions 48 to 52 and consists of three numbers separated by a decimal point. The number to the left of the decimal is the major release number. The digit to the right of the decimal indicates the version of the major release; it is zero for the first version. The sixth line contains a title for the file. The eighth line lists the number of entries (loci), number of bases (or base pairs), and number of reports of sequences (equal to number of entries in this case). These numbers are right-justified at fixed positions. The number of entries appears in positions 1 to 8, the number of bases in positions 16 to 26, and the number of reports in positions 40 to 47. The third, fifth, seventh, and ninth lines are blank. 1 10 20 30 40 50 60 70 79 ---------+---------+---------+---------+---------+---------+---------+--------- GBBCT1.SEQ Genetic Sequence Data Bank October 15 2010 NCBI-GenBank Flat File Release 189.0 Bacterial Sequences (Part 1) 51396 loci, 92682287 bases, from 51396 reported sequences ---------+---------+---------+---------+---------+---------+---------+--------- 1 10 20 30 40 50 60 70 79 Example 1. Sample File Header 3.2 Directory Files 3.2.1 Short Directory File The short directory file contains brief descriptions of all of the sequence entries contained in this release. These descriptions are in fifteen groups, one group for each of the fifteen sequence entry data files. The first record at the beginning of a group of entries contains the name of the group in uppercase characters, beginning in position 21. The organism groups are PRIMATE, RODENT, OTHER MAMMAL, OTHER VERTEBRATE, INVERTEBRATE, PLANT, BACTERIAL, STRUCTURAL RNA, VIRAL, PHAGE, SYNTHETIC, UNANNOTATED, EXPRESSED SEQUENCE TAG, PATENT, or SEQUENCE TAGGED SITE. The second record is blank. Each record in the short directory contains the sequence entry name (LOCUS) in the first 12 positions, followed by a brief definition of the sequence beginning in column 13. The definition is truncated (at the end of a word) to leave room at the right margin for at least one space, the sequence length, and the letters `bp'. The length of the sequence is printed right-justified to column 77, followed by the letters `bp' in columns 78 and 79. The next-to-last record for a group has `ZZZZZZZZZZ' in its first ten positions (where the entry name would normally appear). The last record is a blank line. An example of the short directory file format, showing the descriptions of the last entries in the Other Vertebrate sequence data file and the first entries of the Invertebrate sequence data file, is reproduced below: 1 10 20 30 40 50 60 70 79 ---------+---------+---------+---------+---------+---------+---------+--------- ZEFWNT1G3 B.rerio wnt-1 gene (exon 3) for wnt-1 protein. 266bp ZEFWNT1G4 B.rerio wnt-1 gene (exon 4) for wnt-1 protein. 647bp ZEFZF54 Zebrafish homeotic gene ZF-54. 246bp ZEFZFEN Zebrafish engrailed-like homeobox sequence. 327bp ZZZZZZZZZZ INVERTEBRATE AAHAV33A Acanthocheilonema viteae pepsin-inhibitor-like-protein 1048bp ACAAC01 Acanthamoeba castelani gene encoding actin I. 1571bp ACAACTPH Acanthamoeba castellanii actophorin mRNA, complete cds. 671bp ACAMHCA A.castellanii non-muscle myosin heavy chain gene, partial 5894bp ---------+---------+---------+---------+---------+---------+---------+--------- 1 10 20 30 40 50 60 70 79 Example 2. Short Directory File 3.3 Index Files There are six files containing indices to the entries in this release: Accession number index file (Accession and Version) Secondary accession number index file Keyword phrase index file Author name index file Journal citation index file Gene name index file The index keys (accession numbers, keywords, authors, journals, and gene symbols.) of an index are sorted alphabetically. Following each index key, the identifiers of the sequence entries containing that key are listed (LOCUS name, division abbreviation, and primary accession number). The division abbreviations are: 1. PRI - primate sequences 2. ROD - rodent sequences 3. MAM - other mammalian sequences 4. VRT - other vertebrate sequences 5. INV - invertebrate sequences 6. PLN - plant, fungal, and algal sequences 7. BCT - bacterial sequences 8. VRL - viral sequences 9. PHG - bacteriophage sequences 10. SYN - synthetic sequences 11. UNA - unannotated sequences 12. EST - EST sequences (expressed sequence tags) 13. PAT - patent sequences 14. STS - STS sequences (sequence tagged sites) 15. GSS - GSS sequences (genome survey sequences) 16. HTG - HTGS sequences (high throughput genomic sequences) 17. HTC - HTC sequences (high throughput cDNA sequences) 18. ENV - Environmental sampling sequences 19. CON - Constructed sequences A line-oriented, TAB-delimited format is utilized for the gbaut.idx, gbgen.idx, gbjou.idx, gbkey.idx, and gbsec.idx indexes. Each index key is presented on its own line, and is followed by a LOCUS/Division/Accession triplet for every record containing the key: Indexed-Term LOCUS-name1 Div-code1 Accession1 LOCUS-name2 Div-code2 Accession2 LOCUS-name3 Div-code3 Accession3 .... Here is an example of the format, in which TAB characters are displayed as ^I, and carriage-returns/newlines as $ : (H+,K+)-ATPASE BETA-SUBUNIT$ ^IRATHKATPB^IROD^IM55655$ ^IMUSATP4B1^IROD^IM64685$ ^IMUSATP4B2^IROD^IM64686$ ^IMUSATP4B3^IROD^IM64687$ ^IMUSATP4B4^IROD^IM64688$ ^IDOGATPASEB^IMAM^IM76486$ When viewed by a file browser such as 'less' or 'more' : (H+,K+)-ATPASE BETA-SUBUNIT RATHKATPB ROD M55655 MUSATP4B1 ROD M64685 MUSATP4B2 ROD M64686 MUSATP4B3 ROD M64687 MUSATP4B4 ROD M64688 DOGATPASEB MAM M76486 Note that the index keys can be distinguished from LOCUS/DIV/ACCESSION by the fact that they do not start with a TAB character. So one can extract just the terms via simple text-processing: perl -ne 'print unless /^\s+/' < gbkey.idx > terms.gbkey The format of the primary accession number index file is slightly different, with each indexed key (Accession.Version) present on the same line as the LOCUS/Division/Accession triplet: Accession1.Version1 Locus-name1 Div-code1 Accession1 Accession2.Version2 Locus-name2 Div-code2 Accession2 .... Here is an example of the format, in which TAB characters are displayed as ^I, and carriage-returns/newlines as $ : AC000102.1^IAC000102^IPRI^IAC000102$ AC000103.1^IAC000103^IPLN^IAC000103$ AC000104.1^IF19P19^IPLN^IAC000104$ AC000105.40^IAC000105^IPRI^IAC000105$ AC000106.1^IF7G19^IPLN^IAC000106$ AC000107.1^IAC000107^IPLN^IAC000107$ AC000108.1^IAC000108^IBCT^IAC000108$ AC000109.1^IHSAC000109^IPRI^IAC000109$ AC000110.1^IHSAC000110^IPRI^IAC000110$ When viewed by a file browser such as 'less' or 'more' : AC000102.1 AC000102 PRI AC000102 AC000103.1 AC000103 PLN AC000103 AC000104.1 F19P19 PLN AC000104 AC000105.40 AC000105 PRI AC000105 AC000106.1 F7G19 PLN AC000106 AC000107.1 AC000107 PLN AC000107 AC000108.1 AC000108 BCT AC000108 AC000109.1 HSAC000109 PRI AC000109 AC000110.1 HSAC000110 PRI AC000110 3.3.1 Accession Number Index File - gbacc.idx Accession numbers are unique six character or eight-character alphanumeric identifiers of GenBank database entries. The six-character accession number format consists of a single uppercase letter, followed by 5 digits. The eight-character accession number format consists of two uppercase letters, followed by 6 digits. Accessions provide an unchanging identifier for the data with which they are associated, and we encourage you to cite accession numbers whenever you refer to data from GenBank. GenBank entries can have both 'primary' and 'secondary' accessions associated with them (see Section 3.5.6). Only primary accessions are present in the gbacc.idx index. 3.3.2 Keyword Phrase Index File - gbkey.idx Keyword phrases consist of names for gene products and other characteristics of sequence entries. 3.3.3 Author Name Index File - gbaut*.idx The author name index files list all of the author names that appear in the references within sequence records. 3.3.4 Journal Citation Index File - gbjou.idx The journal citation index file lists all of the citations that appear in the references within sequence records.. All citations are truncated to 80 characters. 3.3.5 Gene Name Index - gbgen.idx The /gene qualifiers of many GenBank entries contain values other than official gene symbols, such as the product or the standard name of the gene. Hence, NCBI has chosen to build an index (gbgen.idx) more like a keyword index for this field, using both the GenBank /gene qualifier and the 'Gene.locus' fields from the NCBI internal database as keys. 3.4 Sequence Entry Files GenBank releases contain one or more sequence entry data files, one for each "division" of GenBank. 3.4.1 File Organization Each of these files has the same format and consists of two parts: header information (described in section 3.1) and sequence entries for that division (described in the following sections). 3.4.2 Entry Organization In the second portion of a sequence entry file (containing the sequence entries for that division), each record (line) consists of two parts. The first part is found in positions 1 to 10 and may contain: 1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is a keyword). 2. A subkeyword beginning in column 3, with columns 1 and 2 blank (e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a subkeyword of REFERENCE). 3. Blank characters, indicating that this record is a continuation of the information under the keyword or subkeyword above it. 4. A code, beginning in column 6, indicating the nature of an entry (feature key) in the FEATURES table; these codes are described in Section 3.4.12.1 below. 5. A number, ending in column 9 of the record. This number occurs in the portion of the entry describing the actual nucleotide sequence and designates the numbering of sequence positions. 6. Two slashes (//) in positions 1 and 2, marking the end of an entry. The second part of each sequence entry record contains the information appropriate to its keyword, in positions 13 to 80 for keywords and positions 11 to 80 for the sequence. The following is a brief description of each entry field. Detailed information about each field may be found in Sections 3.4.4 to 3.4.15. LOCUS - A short mnemonic name for the entry, chosen to suggest the sequence's definition. Mandatory keyword/exactly one record. DEFINITION - A concise description of the sequence. Mandatory keyword/one or more records. ACCESSION - The primary accession number is a unique, unchanging identifier assigned to each GenBank sequence record. (Please use this identifier when citing information from GenBank.) Mandatory keyword/one or more records. VERSION - A compound identifier consisting of the primary accession number and a numeric version number associated with the current version of the sequence data in the record. This is followed by an integer key (a "GI") assigned to the sequence by NCBI. Mandatory keyword/exactly one record. NID - An alternative method of presenting the NCBI GI identifier (described above). NOTE: The NID linetype is obsolete and was removed from the GenBank flatfile format in December 1999. PROJECT - The identifier of a project (such as a Genome Sequencing Project) to which a GenBank sequence record belongs. Optional keyword/one or more records. NOTE: The PROJECT linetype is obsolete and was removed from the GenBank flatfile format after Release 171.0 in April 2009. DBLINK - Provides cross-references to resources that support the existence a sequence record, such as the Project Database and the NCBI Trace Assembly Archive. Optional keyword/one or more records. KEYWORDS - Short phrases describing gene products and other information about an entry. Mandatory keyword in all annotated entries/one or more records. SEGMENT - Information on the order in which this entry appears in a series of discontinuous sequences from the same molecule. Optional keyword (only in segmented entries)/exactly one record. SOURCE - Common name of the organism or the name most frequently used in the literature. Mandatory keyword in all annotated entries/one or more records/includes one subkeyword. ORGANISM - Formal scientific name of the organism (first line) and taxonomic classification levels (second and subsequent lines). Mandatory subkeyword in all annotated entries/two or more records. In the event that the organism name exceeds 68 characters (80 - 13 + 1) in length, it will be line-wrapped and continue on a second line, prior to the taxonomic classification. Unfortunately, very long organism names were not anticipated when the fixed-length GenBank flatfile format was defined in the 1980s. The possibility of linewraps makes the job of flatfile parsers more difficult : essentially, one cannot be sure that the second line is truly a classification/lineage unless it consists of multiple tokens, delimited by semi-colons. The long-term solution to this problem is to introduce an additional subkeyword, probably 'LINEAGE' . This might occur sometime in 2009 or 2010. REFERENCE - Citations for all articles containing data reported in this entry. Includes seven subkeywords and may repeat. Mandatory keyword/one or more records. AUTHORS - Lists the authors of the citation. Optional subkeyword/one or more records. CONSRTM - Lists the collective names of consortiums associated with the citation (eg, International Human Genome Sequencing Consortium), rather than individual author names. Optional subkeyword/one or more records. TITLE - Full title of citation. Optional subkeyword (present in all but unpublished citations)/one or more records. JOURNAL - Lists the journal name, volume, year, and page numbers of the citation. Mandatory subkeyword/one or more records. MEDLINE - Provides the Medline unique identifier for a citation. Optional subkeyword/one record. NOTE: The MEDLINE linetype is obsolete and was removed from the GenBank flatfile format in April 2005. PUBMED - Provides the PubMed unique identifier for a citation. Optional subkeyword/one record. REMARK - Specifies the relevance of a citation to an entry. Optional subkeyword/one or more records. COMMENT - Cross-references to other sequence entries, comparisons to other collections, notes of changes in LOCUS names, and other remarks. Optional keyword/one or more records/may include blank records. FEATURES - Table containing information on portions of the sequence that code for proteins and RNA molecules and information on experimentally determined sites of biological significance. Optional keyword/one or more records. BASE COUNT - Summary of the number of occurrences of each basepair code (a, c, t, g, and other) in the sequence. Optional keyword/exactly one record. NOTE: The BASE COUNT linetype is obsolete and was removed from the GenBank flatfile format in October 2003. CONTIG - This linetype provides information about how individual sequence records can be combined to form larger-scale biological objects, such as chromosomes or complete genomes. Rather than presenting actual sequence data, a special join() statement on the CONTIG line provides the accession numbers and basepair ranges of the underlying records which comprise the object. As of August 2005, the 2L chromosome arm of Drosophila melanogaster (accession number AE014134) provided a good example of CONTIG use. ORIGIN - Specification of how the first base of the reported sequence is operationally located within the genome. Where possible, this includes its location within a larger genetic map. Mandatory keyword/exactly one record. - The ORIGIN line is followed by sequence data (multiple records). // - Entry termination symbol. Mandatory at the end of an entry/exactly one record. 3.4.3 Sample Sequence Data File An example of a complete sequence entry file follows. (This example has only two entries.) Note that in this example, as throughout the data bank, numbers in square brackets indicate items in the REFERENCE list. For example, in ACARR58S, [1] refers to the paper by Mackay, et al. 1 10 20 30 40 50 60 70 79 ---------+---------+---------+---------+---------+---------+---------+--------- GBSMP.SEQ Genetic Sequence Data Bank April 15 1992 GenBank Flat File Release 74.0 Structural RNA Sequences 2 loci, 236 bases, from 2 reported sequences LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986 DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA. ACCESSION K03160 VERSION K03160.1 GI:173593 KEYWORDS 5S ribosomal RNA; ribosomal RNA. SOURCE A.auricula-judae (mushroom) ribosomal RNA. ORGANISM Auricularia auricula-judae Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes; Heterobasidiomycetidae; Auriculariales; Auriculariaceae. REFERENCE 1 (bases 1 to 118) AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R. TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and their use in studying the phylogenetic position of basidiomycetes among the eukaryotes JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983) FEATURES Location/Qualifiers rRNA 1..118 /note="5S ribosomal RNA" BASE COUNT 27 a 34 c 34 g 23 t ORIGIN 5' end of mature rRNA. 1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga 61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt // LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990 DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence. ACCESSION M34766 VERSION M34766.1 GI:173603 KEYWORDS 5S ribosomal RNA. SOURCE Acetobacter sp. (strain MB 58) rRNA. ORGANISM Acetobacter sp. Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci; Azotobacteraceae. REFERENCE 1 (bases 1 to 118) AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I., Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M. TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA sequencing JOURNAL J. Gen. Microbiol. 136, 441-446 (1990) FEATURES Location/Qualifiers rRNA 1..118 /note="5S ribosomal RNA" BASE COUNT 27 a 40 c 32 g 17 t 2 others ORIGIN 1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat 61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy // ---------+---------+---------+---------+---------+---------+---------+--------- 1 10 20 30 40 50 60 70 79 Example 9. Sample Sequence Data File 3.4.4 LOCUS Format The items of information contained in the LOCUS record are always found in fixed positions. The locus name (or entry name), which is always sixteen characters or less, begins in position 13. The locus name is designed to help group entries with similar sequences: the first three characters usually designate the organism; the fourth and fifth characters can be used to show other group designations, such as gene product; for segmented entries the last character is one of a series of sequential integers. The number of bases or base pairs in the sequence ends in position 40. The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide the number of strands of the sequence. Positions 48 to 53 indicate the type of molecule sequenced. Topology of the molecule is indicated in positions 56 to 63. GenBank sequence entries are divided among many different 'divisions'. Each entry's division is specified by a three-letter code in positions 65 to 67. See Section 3.3 for an explanation of division codes. Positions 69 to 79 of the record contain the date the entry was entered or underwent any substantial revisions, such as the addition of newly published data, in the form dd-MMM-yyyy. The detailed format for the LOCUS line format is as follows: Positions Contents --------- -------- 01-05 'LOCUS' 06-12 spaces 13-28 Locus name 29-29 space 30-40 Length of sequence, right-justified 41-41 space 42-43 bp 44-44 space 45-47 spaces, ss- (single-stranded), ds- (double-stranded), or ms- (mixed-stranded) 48-53 NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), mRNA (messenger RNA), uRNA (small nuclear RNA). Left justified. 54-55 space 56-63 'linear' followed by two spaces, or 'circular' 64-64 space 65-67 The division code (see Section 3.3) 68-68 space 69-79 Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991) Although each of these data values can be found at column-specific positions, we encourage those who parse the contents of the LOCUS line to use a token-based approach. This will prevent the need for software changes if the spacing of the data values ever has to be modified. Note that all non-coding RNA sequences have a molecule type of 'RNA'. Further information about the specific type of non-coding RNA can be obtained from the full-length ncRNA feature that will be present on such sequences. 3.4.5 DEFINITION Format The DEFINITION record gives a brief description of the sequence, proceeding from general to specific. It starts with the common name of the source organism, then gives the criteria by which this sequence is distinguished from the remainder of the source genome, such as the gene name and what it codes for, or the protein name and mRNA, or some description of the sequence's function (if the sequence is non-coding). If the sequence has a coding region, the description may be followed by a completeness qualifier, such as cds (complete coding sequence). There is no limit on the number of lines that may be part of the DEFINITION. The last line must end with a period. 3.4.5.1 DEFINITION Format for NLM Entries The DEFINITION line for entries derived from journal-scanning at the NLM is an automatically generated descriptive summary that accompanies each DNA and protein sequence. It contains information derived from fields in a database that summarize the most important attributes of the sequence. The DEFINITION lines are designed to supplement the accession number and the sequence itself as a means of uniquely and completely specifying DNA and protein sequences. The following are examples of NLM DEFINITION lines: NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt] 94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA Partial, 1 gene, 1873 nt] inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment 1 of 2] cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase [Acremonium chrysogenum, Genomic, 2 genes, 2639 nt] myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails, embryo, Peptide Partial, 246 aa] The first part of the definition line contains information describing the genes and proteins represented by the molecular sequences. This can be gene locus names, protein names and descriptions that replace or augment actual names. Gene and gene product are linked by "=". Any special identifying terms are presented within brackets, such as: {promoter}, {N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}. The second part of the definition line is delimited by square brackets, '[]', and provides details about the molecule type and length. The biological source, i.e., genus and species or common name as cited by the author. Developmental stage, tissue type and strain are included if available. The molecule types include: Genomic, mRNA, Peptide. and Other Genomic Material. Genomic molecules are assumed to be partial sequence unless "Complete" is specified, whereas mRNA and peptide molecules are assumed to be complete unless "Partial" is noted. 3.4.6 ACCESSION Format This field contains a series of six-character and/or eight-character identifiers called 'accession numbers'. The six-character accession number format consists of a single uppercase letter, followed by 5 digits. The eight-character accession number format consists of two uppercase letters, followed by 6 digits. The 'primary', or first, of the accession numbers occupies positions 13 to 18 (6-character format) or positions 13 to 20 (8-character format). Subsequent 'secondary' accession numbers (if present) are separated from the primary, and from each other, by a single space. In some cases, multiple lines of secondary accession numbers might be present, starting at position 13. The primary accession number of a GenBank entry provides a stable identifier for the biological object that the entry represents. Accessions do not change when the underlying sequence data or associated features change. Secondary accession numbers arise for a number of reasons. For example, a single accession number may initially be assigned to a sequence described in a publication. If it is later discovered that the sequence must be entered into the database as multiple entries, each entry would receive a new primary accession number, and the original accession number would appear as a secondary accession number on each of the new entries. In the event that a large number of continuous secondary accession numbers exist, a range can be employed: SecAccession1-SecAccession2 In such cases, the alphabetic prefix letters of the initial and terminal accession numbers within the range *MUST* be identical. For example: AE000111-AE000510O ^^ ^^ Additionally, the value of the numeric portion of the initial secondary within the range must be less than the value of the numeric portion of the terminal secondary. 3.4.7.1 VERSION Format This line contains two types of identifiers for a GenBank database entry: a compound accession number and an NCBI GI identifier. LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999 DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds. ACCESSION AF181452 VERSION AF181452.1 GI:6017929 ^^^^^^^^^^ ^^^^^^^^^^ Compound NCBI GI Accession Identifier Number A compound accession number consists of two parts: a stable, unchanging primary-accession number portion (see Section 3.4.6 for a description of accession numbers), and a sequentially increasing numeric version number. The accession and version numbers are separated by a period. The initial version number assigned to a new sequence is one. Compound accessions are often referred to as "Accession.Version" . An accession number allows one to retrieve the same biological object in the database, regardless of any changes that are made to the entry over time. But those changes can include changes to the sequence data itself, which is of fundamental importance to many database users. So a numeric version number is associated with the sequence data in every database entry. If an entry (for example, AF181452) undergoes two sequence changes, its compound accession number on the VERSION line would start as AF181452.1 . After the first sequence change this would become: AF181452.2 . And after the second change: AF181452.3 . The NCBI GI identifier of the VERSION line also serves as a method for identifying the sequence data that has existed for a database entry over time. GI identifiers are numeric values of one or more digits. Since they are integer keys, they are less human-friendly than the Accession.Version system described above. Returning to our example for AF181452, it was initially assigned GI 6017929. If the sequence changes, a new integer GI will be assigned, perhaps 7345003 . And after the second sequence change, perhaps the GI would become 10456892 . Why are both these methods for identifying the version of the sequence associated with a database entry in use? For two reasons: - Some data sources processed by NCBI for incorporation into its Entrez sequence retrieval system do not version their own sequences. - GIs provide a uniform, integer identifier system for every sequence NCBI has processed. Some products and systems derived from (or reliant upon) NCBI products and services prefer to use these integer identifiers because they can all be processed in the same manner. GenBank Releases contain only the most recent versions of all sequences in the database. However, older versions can be obtained via GI-based or Accession.Version-based queries with NCBI's web-Entrez and network-Entrez applications. A sequence revision history web page is also available: http://www.ncbi.nlm.nih.gov/htbin-post/Entrez/girevhist NOTE: All the version numbers for the compound Accession.Version identifier system were initialized to a value of one in February 1999, when the system was first introduced. 3.4.7.2 DBLINK Format This line contains cross-references to other underlying resources that support the existence of a GenBank sequence record. For example: LOCUS AAWZ01000001 40763 bp DNA linear VRT 15-FEB-2007 DEFINITION Anolis carolinensis cont1.0, whole genome shotgun sequence. ACCESSION AAWZ01000001 AAWZ01000000 VERSION AAWZ01000001.1 GI:125802685 DBLINK Project:18787 A DBLINK cross-reference consists of two data fields delimited by a colon. The first field provides the cross-reference type ("Project"), while the second contains the actual cross-reference identifier ("18787"). The second field can consist of multiple comma-separated identifiers, if a sequence record has multiple DBLINK cross-references of a given type. For example: DBLINK Project:100,200,300 DBLINK cross-references of type 'Project' are identifiers within the 'Entrez:Project' database at the NCBI: http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=genomeprj At the above URL, a search for 18787 would provide information about the sequencing projects (underway or completed) for Anolis carolinensis, the centers performing the sequencing and annotation, information about the organism, etc. For a more detailed overview of Entrez's Project database: http://www.ncbi.nlm.nih.gov/genomes/static/gprj_help.html#introduction As of April 2009, the supported DBLINK cross-reference types are "Project" and "Trace Assembly Archive" . 3.4.8 KEYWORDS Format The KEYWORDS field does not appear in unannotated entries, but is required in all annotated entries. Keywords are separated by semicolons; a "keyword" may be a single word or a phrase consisting of several words. Each line in the keywords field ends in a semicolon; the last line ends with a period. If no keywords are included in the entry, the KEYWORDS record contains only a period. 3.4.9 SEGMENT Format The SEGMENT keyword is used when two (or more) entries of known relative orientation are separated by a short (<10 kb) stretch of DNA. It is limited to one line of the form `n of m', where `n' is the segment number of the current entry and `m' is the total number of segments. 3.4.10 SOURCE Format The SOURCE field consists of two parts. The first part is found after the SOURCE keyword and contains free-format information including an abbreviated form of the organism name followed by a molecule type; multiple lines are allowed, but the last line must end with a period. The second part consists of information found after the ORGANISM subkeyword. The formal scientific name for the source organism (genus and species, where appropriate) is found on the same line as ORGANISM. The records following the ORGANISM line list the taxonomic classification levels, separated by semicolons and ending with a period. 3.4.11 REFERENCE Format The REFERENCE field consists of five parts: the keyword REFERENCE, and the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional), PUBMED (optional), and REMARK (optional). The REFERENCE line contains the number of the particular reference and (in parentheses) the range of bases in the sequence entry reported in this citation. Additional prose notes may also be found within the parentheses. The numbering of the references does not reflect publication dates or priorities. The AUTHORS line lists the authors in the order in which they appear in the cited article. Last names are separated from initials by a comma (no space); there is no comma before the final `and'. The list of authors ends with a period. The TITLE line is an optional field, although it appears in the majority of entries. It does not appear in unpublished sequence data entries that have been deposited directly into the GenBank data bank, the EMBL Nucleotide Sequence Data Library, or the DNA Data Bank of Japan. The TITLE field does not end with a period. The JOURNAL line gives the appropriate literature citation for the sequence in the entry. The word `Unpublished' will appear after the JOURNAL subkeyword if the data did not appear in the scientific literature, but was directly deposited into the data bank. For published sequences the JOURNAL line gives the Thesis, Journal, or Book citation, including the year of publication, the specific citation, or In press. For Book citations, the JOURNAL line is specially-formatted, and includes: editor name(s) book title page number(s) publisher-name/publisher-location year For example: LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003 DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene, partial sequence. ACCESSION AY277550 .... REFERENCE 1 (bases 1 to 1440) AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C. TITLE Classifying bacterial isolates from hypogean environments: Application of a novel fluorimetric method dor the estimation of G+C mol% content in microorganisms by thermal denaturation temperature JOURNAL (in) Saiz-Jimenez,C. (Ed.); MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54; A.A. Balkema, The Netherlands (2003) The presence of "(in)" signals the fact that the reference is for a book rather than a journal article. A semi-colon signals the end of the editor names. The next semi-colon signals the end of the page numbers, and the colon that immediately *precedes* the page numbers signals the end of the book title. The publisher name and location are a free-form text string. Finally, the year appears at the very end of the JOURNAL line, enclosed in parentheses. The MEDLINE line provides the National Library of Medicine's Medline unique identifier for a citation (if known). Medline UIs are 8 digit numbers. The PUBMED line provides the PubMed unique identifier for a citation (if known). PUBMED ids are numeric, and are record identifiers for article abstracts in the PubMed database : http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed Citations in PubMed that do not fall within Medline's scope will have only a PUBMED identifier. Similarly, citations that *are* in Medline's scope but which have not yet been assigned Medline UIs will have only a PUBMED identifier. If a citation is present in both the PubMed and Medline databases, both a MEDLINE and a PUBMED line will be present. The REMARK line is a textual comment that specifies the relevance of the citation to the entry. 3.4.12 FEATURES Format GenBank releases use a feature table format designed jointly by GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data Bank of Japan. This format is in use by all three databases. The most complete and accurate Feature Table documentation can be found on the Web at: http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html Any discrepancy between the abbreviated feature table description of these release notes and the complete documentation on the Web should be resolved in favor of the version at the above URL. The Feature Table specification is also available as a printed document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact GenBank at the address shown on the first page of these Release Notes if you would like a copy. The feature table contains information about genes and gene products, as well as regions of biological significance reported in the sequence. The feature table contains information on regions of the sequence that code for proteins and RNA molecules. It also enumerates differences between different reports of the same sequence, and provides cross-references to other data collections, as described in more detail below. The first line of the feature table is a header that includes the keyword `FEATURES' and the column header `Location/Qualifier.' Each feature consists of a descriptor line containing a feature key and a location (see sections below for details). If the location does not fit on this line, a continuation line may follow. If further information about the feature is required, one or more lines containing feature qualifiers may follow the descriptor line. The feature key begins in column 6 and may be no more than 15 characters in length. The location begins in column 22. Feature qualifiers begin on subsequent lines at column 22. Location, qualifier, and continuation lines may extend from column 22 to 80. Feature tables are required, due to the mandatory presence of the source feature. The sections below provide a brief introduction to the feature table format. 3.4.12.1 Feature Key Names The first column of the feature descriptor line contains the feature key. It starts at column 6 and can continue to column 20. The list of valid feature keys is shown below. Remember, the most definitive documentation for the feature table can be found at: http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html allele Obsolete; see variation feature key attenuator Sequence related to transcription termination C_region Span of the C immunological feature CAAT_signal `CAAT box' in eukaryotic promoters CDS Sequence coding for amino acids in protein (includes stop codon) conflict Independent sequence determinations differ D-loop Displacement loop D_segment Span of the D immunological feature enhancer Cis-acting enhancer of promoter function exon Region that codes for part of spliced mRNA gene Region that defines a functional gene, possibly including upstream (promotor, enhancer, etc) and downstream control elements, and for which a name has been assigned. GC_signal `GC box' in eukaryotic promoters iDNA Intervening DNA eliminated by recombination intron Transcribed region excised by mRNA splicing J_region Span of the J immunological feature LTR Long terminal repeat mat_peptide Mature peptide coding region (does not include stop codon) misc_binding Miscellaneous binding site misc_difference Miscellaneous difference feature misc_feature Region of biological significance that cannot be described by any other feature misc_recomb Miscellaneous recombination feature misc_RNA Miscellaneous transcript feature not defined by other RNA keys misc_signal Miscellaneous signal misc_structure Miscellaneous DNA or RNA structure modified_base The indicated base is a modified nucleotide mRNA Messenger RNA mutation Obsolete: see variation feature key N_region Span of the N immunological feature old_sequence Presented sequence revises a previous version polyA_signal Signal for cleavage & polyadenylation polyA_site Site at which polyadenine is added to mRNA precursor_RNA Any RNA species that is not yet the mature RNA product prim_transcript Primary (unprocessed) transcript primer Primer binding region used with PCR primer_bind Non-covalent primer binding site promoter A region involved in transcription initiation protein_bind Non-covalent protein binding site on DNA or RNA RBS Ribosome binding site rep_origin Replication origin for duplex DNA repeat_region Sequence containing repeated subsequences repeat_unit One repeated unit of a repeat_region rRNA Ribosomal RNA S_region Span of the S immunological feature satellite Satellite repeated sequence scRNA Small cytoplasmic RNA sig_peptide Signal peptide coding region snRNA Small nuclear RNA source Biological source of the sequence data represented by a GenBank record. Mandatory feature, one or more per record. For organisms that have been incorporated within the NCBI taxonomy database, an associated /db_xref="taxon:NNNN" qualifier will be present (where NNNNN is the numeric identifier assigned to the organism within the NCBI taxonomy database). stem_loop Hair-pin loop structure in DNA or RNA STS Sequence Tagged Site; operationally unique sequence that identifies the combination of primer spans used in a PCR assay TATA_signal `TATA box' in eukaryotic promoters terminator Sequence causing transcription termination transit_peptide Transit peptide coding region transposon Transposable element (TN) tRNA Transfer RNA unsure Authors are unsure about the sequence in this region V_region Span of the V immunological feature variation A related population contains stable mutation - (hyphen) Placeholder -10_signal `Pribnow box' in prokaryotic promoters -35_signal `-35 box' in prokaryotic promoters 3'clip 3'-most region of a precursor transcript removed in processing 3'UTR 3' untranslated region (trailer) 5'clip 5'-most region of a precursor transcript removed in processing 5'UTR 5' untranslated region (leader) 3.4.12.2 Feature Location The second column of the feature descriptor line designates the location of the feature in the sequence. The location descriptor begins at position 22. Several conventions are used to indicate sequence location. Base numbers in location descriptors refer to numbering in the entry, which is not necessarily the same as the numbering scheme used in the published report. The first base in the presented sequence is numbered base 1. Sequences are presented in the 5' to 3' direction. Location descriptors can be one of the following: 1. A single base; 2. A contiguous span of bases; 3. A site between two bases; 4. A single base chosen from a range of bases; 5. A single base chosen from among two or more specified bases; 6. A joining of sequence spans; 7. A reference to an entry other than the one to which the feature belongs (i.e., a remote entry), followed by a location descriptor referring to the remote sequence; A site between two residues, such as an endonuclease cleavage site, is indicated by listing the two bases separated by a carat (e.g., 23^24). A single residue chosen from a range of residues is indicated by the number of the first and last bases in the range separated by a single period (e.g., 23.79). The symbols < and > indicate that the end point of the range is beyond the specified base number. A contiguous span of bases is indicated by the number of the first and last bases in the range separated by two periods (e.g., 23..79). The symbols < and > indicate that the end point of the range is beyond the specified base number. Starting and ending positions can be indicated by base number or by one of the operators described below. Operators are prefixes that specify what must be done to the indicated sequence to locate the feature. The following are the operators available, along with their most common format and a description. complement (location): The feature is complementary to the location indicated. Complementary strands are read 5' to 3'. join (location, location, .. location): The indicated elements should be placed end to end to form one contiguous sequence. order (location, location, .. location): The elements are found in the specified order in the 5 to 3 direction, but nothing is implied about the rationality of joining them. 3.4.12.3 Feature Qualifiers Qualifiers provide additional information about features. They take the form of a slash (/) followed by a qualifier name and, if applicable, an equal sign (=) and a qualifier value. Feature qualifiers begin at column 22. Qualifiers convey many types of information. Their values can, therefore, take several forms: 1. Free text; 2. Controlled vocabulary or enumerated values; 3. Citations or reference numbers; 4. Sequences; 5. Feature labels. Text qualifier values must be enclosed in double quotation marks. The text can consist of any printable characters (ASCII values 32-126 decimal). If the text string includes double quotation marks, each set must be `escaped' by placing a double quotation mark in front of it (e.g., /note="This is an example of ""escaped"" quotation marks"). Some qualifiers require values selected from a limited set of choices. For example, the `/direction' qualifier has only three values `left,' `right,' or `both.' These are called controlled vocabulary qualifier values. Controlled qualifier values are not case sensitive; they can be entered in any combination of upper- and lowercase without changing their meaning. Citation or published reference numbers for the entry should be enclosed in square brackets ([]) to distinguish them from other numbers. A literal sequence of bases (e.g., "atgcatt") should be enclosed in quotation marks. Literal sequences are distinguished from free text by context. Qualifiers that take free text as their values do not take literal sequences, and vice versa. The `/label=' qualifier takes a feature label as its qualifier. Although feature labels are optional, they allow unambiguous references to the feature. The feature label identifies a feature within an entry; when combined with the accession number and the name of the data bank from which it came, it is a unique tag for that feature. Feature labels must be unique within an entry, but can be the same as a feature label in another entry. Feature labels are not case sensitive; they can be entered in any combination of upper-and lowercase without changing their meaning. The following is a partial list of feature qualifiers. /anticodon Location of the anticodon of tRNA and the amino acid for which it codes /bound_moiety Moiety bound /citation Reference to a citation providing the claim of or evidence for a feature /codon Specifies a codon that is different from any found in the reference genetic code /codon_start Indicates the first base of the first complete codon in a CDS (as 1 or 2 or 3) /cons_splice Identifies intron splice sites that do not conform to the 5'-GT... AG-3' splice site consensus /db_xref A database cross-reference; pointer to related information in another database. A description of all cross-references can be found at: http://www.ncbi.nlm.nih.gov/collab/db_xref.html /direction Direction of DNA replication /EC_number Enzyme Commission number for the enzyme product of the sequence /evidence Value indicating the nature of supporting evidence /frequency Frequency of the occurrence of a feature /function Function attributed to a sequence /gene Symbol of the gene corresponding to a sequence region (usable with all features) /label A label used to permanently identify a feature /map Map position of the feature in free-format text /mod_base Abbreviation for a modified nucleotide base /note Any comment or additional information /number A number indicating the order of genetic elements (e.g., exons or introns) in the 5 to 3 direction /organism Name of the organism that is the source of the sequence data in the record. /partial Differentiates between complete regions and partial ones /phenotype Phenotype conferred by the feature /product Name of a product encoded by a coding region (CDS) feature /pseudo Indicates that this feature is a non-functional version of the element named by the feature key /rpt_family Type of repeated sequence; Alu or Kpn, for example /rpt_type Organization of repeated sequence /rpt_unit Identity of repeat unit that constitutes a repeat_region /standard_name Accepted standard name for this feature /transl_except Translational exception: single codon, the translation of which does not conform to the reference genetic code /translation Amino acid translation of a coding region /type Name of a strain if different from that in the SOURCE field /usedin Indicates that feature is used in a compound feature in another entry 3.4.12.4 Cross-Reference Information One type of information in the feature table lists cross-references to the annual compilation of transfer RNA sequences in Nucleic Acids Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl. Each tRNA entry of the feature table contains a /note= qualifier that includes a reference such as `(NAR: 1234)' to identify code 1234 in the NAR compilation. When such a cross-reference appears in an entry that contains a gene coding for a transfer RNA molecule, it refers to the code in the tRNA gene compilation. Similar cross-references in entries containing mature transfer RNA sequences refer to the companion compilation of tRNA sequences published by D.H. Gauss and M. Sprinzl in Nucleic Acids Research. 3.4.12.5 Feature Table Examples In the first example a number of key names, feature locations, and qualifiers are illustrated, taken from different sequences. The first table entry is a coding region consisting of a simple span of bases and including a /gene qualifier. In the second table entry, an NAR cross-reference is given (see the previous section for a discussion of these cross-references). The third and fourth table entries use the symbols `<`and `>' to indicate that the beginning or end of the feature is beyond the range of the presented sequence. In the fifth table entry, the symbol `^' indicates that the feature is between bases. 1 10 20 30 40 50 60 70 79 ---------+---------+---------+---------+---------+---------+---------+--------- CDS 5..1261 /product="alpha-1-antitrypsin precursor" /map="14q32.1" /gene="PI" tRNA 1..87 /note="Leu-tRNA-CAA (NAR: 1057)" /anticodon=(pos:35..37,aa:Leu) mRNA 1..>66 /note="alpha-1-acid glycoprotein mRNA" transposon <1..267 /note="insertion element IS5" misc_recomb 105^106 /note="B.subtilis DNA end/IS5 DNA start" conflict 258 /replace="t" /citation=[2] ---------+---------+---------+---------+---------+---------+---------+--------- 1 10 20 30 40 50 60 70 79 Example 10. Feature Table Entries The next example shows the representation for a CDS that spans more than one entry. 1 10 20 30 40 50 60 70 79 ---------+---------+---------+---------+---------+---------+---------+--------- LOCUS HUMPGAMM1 3688 bp ds-DNA PRI 15-OCT-1990 DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M) gene, 5' end. ACCESSION M55673 M25818 M27095 KEYWORDS phosphoglycerate mutase. SEGMENT 1 of 2 . . . FEATURES Location/Qualifiers CAAT_signal 1751..1755 /gene="PGAM-M" TATA_signal 1791..1799 /gene="PGAM-M" exon 1820..2274 /number=1 /EC_number="5.4.2.1" /gene="PGAM-M" intron 2275..2377 /number=1 /gene="PGAM2" exon 2378..2558 /number=2 /gene="PGAM-M" . . . // LOCUS HUMPGAMM2 677 bp ds-DNA PRI 15-OCT-1990 DEFINITION Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M), exon 3. ACCESSION M55674 M25818 M27096 KEYWORDS phosphoglycerate mutase. SEGMENT 2 of 2 . . . FEATURES Location/Qualifiers exon 255..457 /number=3 /gene="PGAM-M" intron order(M55673:2559..>3688,<1..254) /number=2 /gene="PGAM-M" mRNA join(M55673:1820..2274,M55673:2378..2558,255..457) /gene="PGAM-M" CDS join(M55673:1861..2274,M55673:2378..2558,255..421) /note="muscle-specific isozyme" /gene="PGAM2" /product="phosphoglycerate mutase" /codon_start=1 /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK" . . . // ---------+---------+---------+---------+---------+---------+---------+--------- 1 10 20 30 40 50 60 70 79 Example 11. Joining Sequences 3.4.13 ORIGIN Format The ORIGIN record may be left blank, may appear as `Unreported.' or may give a local pointer to the sequence start, usually involving an experimentally determined restriction cleavage site or the genetic locus (if available). The ORIGIN record ends in a period if it contains data, but does not include the period if the record is left empty (in contrast to the KEYWORDS field which contains a period rather than being left blank). 3.4.14 SEQUENCE Format The nucleotide sequence for an entry is found in the records following the ORIGIN record. The sequence is reported in the 5' to 3' direction. There are sixty bases per record, listed in groups of ten bases followed by a blank, starting at position 11 of each record. The number of the first nucleotide in the record is given in columns 4 to 9 (right justified) of the record. 3.4.15 CONTIG Format As an alternative to SEQUENCE, a CONTIG record can be present following the ORIGIN record. A join() statement utilizing a syntax similar to that of feature locations (see the Feature Table specification mentioned in Section 3.4.12) provides the accession numbers and basepair ranges of other GenBank sequences which contribute to a large-scale biological object, such as a chromosome or complete genome. Here is an example of the use of CONTIG : CONTIG join(AE003590.3:1..305900,AE003589.4:61..306076, AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696, AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641, [ lines removed for brevity ] AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856) However, the CONTIG join() statement can also utilize a special operator which is *not* part of the syntax for feature locations: gap() : Gap of unknown length. gap(X) : Gap with an estimated integer length of X bases. To be represented as a run of n's of length X in the sequence that can be constructed from the CONTIG line join() statement . gap(unkX) : Gap of unknown length, which is to be represented as an integer number (X) of n's in the sequence that can be constructed from the CONTIG line join() statement. The value of this gap operator consists of the literal characters 'unk', followed by an integer. Here is an example of a CONTIG line join() that utilizes the gap() operator: CONTIG join(complement(AADE01002756.1:1..10234),gap(1206), AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633), AADE01005641.1:1..2377) The first and last elements of the join() statement may be a gap() operator. But if so, then those gaps should represent telomeres, centromeres, etc. Consecutive gap() operators are illegal. 4. ALTERNATE RELEASES NCBI is supplying sequence data in the GenBank flat file format to maintain compatibility with existing software which require that particular format. Although we have made every effort to ensure that these data are presented in the traditional flat file format, if you encounter any problems in using these data with software which is based upon the flat file format, please contact us at: info@ncbi.nlm.nih.gov The flat file is just one of many possible report formats that can be generated from the richer representation supported by the ASN.1 form of the data. Developers of new software tools should consider using the ASN.1 form directly to take advantage of those features. Documentation and a Software Developer's Toolkit for ASN.1 are available through NCBI. You may call NCBI at (301)496-2475, or subscribe to a developers' electronic newsgroup by sending your name, address, affiliation, and e-mail address to: bits-request@ncbi.nlm.nih.gov The Software Developer's Toolkit and PostScript documentation for UNIX, VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov', in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'. 5. KNOWN PROBLEMS OF THE GENBANK DATABASE 5.1 Incorrect Gene Symbols in Entries and Index The /gene qualifier for many GenBank entries contains values other than the official gene symbol, such as the product or the standard name of the gene. The gene symbol index (gbgen.idx) is created from the data in the /gene qualifier and therefore may contain data other than official gene symbols. 6. GENBANK ADMINISTRATION The National Center for Biotechnology Information (NCBI), National Library of Medicine, National Institutes of Health, is responsible for the production and distribution of the NIH GenBank Sequence Database. NCBI distributes GenBank sequence data by anonymous FTP, e-mail servers and other network services. For more information, you may contact NCBI at the e-mail address: info@ncbi.nlm.nih.gov or by phone: 301-496-2475. 6.1 Registered Trademark Notice GenBank (R) is a registered trademark of the U.S. Department of Health and Human Services for the Genetic Sequence Data Bank. 6.2 Citing GenBank If you have used GenBank in your research, we would appreciate it if you would include a reference to GenBank in all publications related to that research. When citing data in GenBank, it is appropriate to give the sequence name, primary accession number, and the publication in which the sequence first appeared. If the data are unpublished, we urge you to contact the group which submitted the data to GenBank to see if there is a recent publication or if they have determined any revisions or extensions of the data. It is also appropriate to list a reference for GenBank itself. The following publication, which describes the GenBank database, should be cited: Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Wheeler DL. GenBank. Nucleic Acids Res. 36(Database issue), D25-30 (2008) The following statement is an example of how you may cite GenBank data. It cites the sequence, its primary accession number, the group who determined the sequence, and GenBank. The numbers in parentheses refer to the GenBank citation above and to the REFERENCE in the GenBank sequence entry. `We scanned the GenBank (1) database for sequence similarities and found one sequence (2), GenBank accession number J01016, which showed significant similarity...' (1) Benson, D.A. et al, Nucleic Acids Res. 36(Database issue), D25-30 (2008) (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982) 6.3 GenBank Distribution Formats and Media Complete flat file releases of the GenBank database are available via NCBI's anonymous ftp server: ftp://ftp.ncbi.nih.gov Each release is cumulative, incorporating all previous GenBank data. No retrieval software is provided. GenBank distribution via CD-ROM ceased as of GenBank Release 106.0 (April, 1998). A mirror of the GenBank FTP site at the NCBI is available at the University of Indiana: ftp://bio-mirror.net/biomirror/genbank/ 6.4 Other Methods of Accessing GenBank Data Entrez is a molecular biology database system that presents an integrated view of DNA and protein sequence data, 3D structure data, complete genomes, and associated MEDLINE entries. The system is produced by the National Center for Biotechnology Information (NCBI), and is available only via the Internet (using the Web-Entrez and Network-Entrez applications). Accessing Entrez is easy: if you have a World Wide Web browser, such as Netscape or Internet-Explorer, simply point your browser to: http://www.ncbi.nlm.nih.gov/ The Web version of Entrez has all the capabilities of the network version, but with the visual style of the World Wide Web. If you prefer the "look and feel" of Network-Entrez, you may download Network-Entrez from the NCBI's FTP server: ftp://ftp.ncbi.nih.gov/ Versions are available for PC/Windows, Macintosh and several Unix variants. For information about Network-Entrez, Web-Entrez or any other NCBI services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by phone at 301-496-2475. 6.5 Request for Corrections and Comments We welcome your suggestions for improvements to GenBank. We are especially interested to learn of errors or inconsistencies in the data. BankIt or Sequin can be used to submit revisions to previous submissions. In addition, suggestions and corrections can be sent by electronic mail to: update@ncbi.nlm.nih.gov. Please be certain to indicate the GenBank release number (e.g., Release 189.0) and the primary accession number of the entry to which your comments apply; it is helpful if you also give the entry name and the current contents of any data field for which you are recommending a change. 6.6 Credits and Acknowledgments Credits - GenBank Release Coordination Mark Cavanaugh GenBank Submission Coordination Ilene Mizrachi GenBank Annotation Staff Yiming Bao, Michael Baxter, Lori Black, Larissa Brown, Vincent Calhoun, Larry Chlumsky, Karen Clark, Jianli Dai, Michel Eschenbrenner, Irene Fang, Michael Fetchko, Linda Frisse, Andrea Gocke, Anjanette Johnston, Mark Landree, Jason Lowry, Richard McVeigh, Ilene Mizrachi, DeAnne Olsen Cravaritis, Leigh Riley, Susan Schafer, Beverly Underwood, Melissa Wright, and Linda Yankie Data Management and Preparation Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi, Ilya Dondoshansky, WonHee Jang, Jonathan Kans, Leonid Khotomliansky, Michael Kimelman, Jim Ostell, Denis Sinyakov, Karl Sirotkin, Vladimir Soussov, Elena Starchenko, Hanzhen Sun, Tatiana Tatusova, Lukas Wagner, Eugene Yaschenko, Sergey Zhdanov Database Administration Slava Khotomliansky, Igor Lozitskiy, Craig Oakley, Eugene Semenov, Ben Slade, Constantin Vasilyev User Support Peter Cooper, Hanguan Liu, Wayne Matten, Scott McGinnis, Rana Morris, Steve Pechous, Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian Project Direction David Lipman Acknowledgments - Contractor support for GenBank production and distribution has been provided by Management Systems Designers, Inc., ComputerCraft Corporation, and The KEVRIC Company, Inc. 6.7 Disclaimer The United States Government makes no representations or warranties regarding the content or accuracy of the information. The United States Government also makes no representations or warranties of merchantability or fitness for a particular purpose or that the use of the sequences will not infringe any patent, copyright, trademark, or other rights. The United States Government accepts no responsibility for any consequence of the receipt or use of the information. For additional information about GenBank releases, please contact NCBI by e-mail at info@ncbi.nlm.nih.gov, by phone at (301) 496-2475, or by mail at: GenBank National Library of Medicine Bldg. 38A Rm. 8N-809 8600 Rockville Pike Bethesda, MD 20894 FAX: (301) 480-9241